PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G111760_P01
Common NameLOC100273304
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Trihelix
Protein Properties Length: 664aa    MW: 70652.3 Da    PI: 5.9904
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G111760_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix98.17.6e-31495579186
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                        rW+k+ev aLi++r+ +e r+++  lk+plWeevs++m++ g+ r++k+Ckekwen+nk+++k ke+ kkr + + +tcpyfd+l+
  GRMZM2G111760_P01 495 RWPKHEVEALIRVRTGLEGRFQELGLKGPLWEEVSARMAAAGYGRNAKRCKEKWENINKYFRKAKESGKKR-PAHAKTCPYFDELD 579
                        8********************************************************************98.99999*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.027494552IPR017877Myb-like domain
CDDcd122033.11E-29494559No hitNo description
PfamPF138371.8E-22494581No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 664 aa     Download sequence    Send to blast
MQSGYGGVSE FQQFIMDGGF AMSAPPQQQQ PPATAQEMGG PFRYQPLHHH ALPPPHHHHH  60
AQHMPPHFAH FGAAPPPPPF TQQLLHQAAA GGHHHLQLFH EQQHHHKPQP PARWAPHPHH  120
HHHHHHLGFD VEAAVPESSG AAGGGSAGAS AGAAPSGVPP FLAAAMNFKL AVDAGGGSGA  180
TEGTDDGGGA AGSGMMLHVG SGGGGGDEAA TESRLRRWTG DEETSIKEPT WRPLDIDYLQ  240
SSSSSKRTGK EKVATPAAPA NYFKKGDAAA AGGGNYKLFS ELEAIYKPGS GGAQTGSGSC  300
LTGDDNAILE PAVADLPAVG PQQLNTSETS AGEEAAAVVQ PQQQPQASAD AARRKRKRRR  360
QEQLSASASF FERLVQRLME HQESLHRGFL EAMERRERER AARDEAWRRQ EADKFAREAG  420
ARAQDRASAA AREAAIIAYL EKISGESITL PAPPAAAASG DDATAAGKEL VPYDGGDATA  480
AEGGGGSLHL SSTSRWPKHE VEALIRVRTG LEGRFQELGL KGPLWEEVSA RMAAAGYGRN  540
AKRCKEKWEN INKYFRKAKE SGKKRPAHAK TCPYFDELDR LYSRSADGGG GEARQLGSSE  600
LLDAVIKYPD VRYGPPVFGG GNANNEGGED DDSDGEEEEE EEEDGIGKGR AGDDQDDEVD  660
NDDE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1352357RRKRKR
2353358RKRKRR
3353359RKRKRRR
4354359KRKRRR
5355359RKRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.413290.0meristem| ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G111760
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G111760_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0407370.0BT040737.1 Zea mays full-length cDNA clone ZM_BFc0121H15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008681430.10.0uncharacterized protein LOC100273304 isoform X1
TrEMBLA0A1D6GXX80.0A0A1D6GXX8_MAIZE; Trihelix transcription factor GTL2
STRINGGRMZM2G111760_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63993547
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.29e-37Trihelix family protein