PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G111696_P01
Common NameLOC103647922, LOC542193, Zm.19855
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family VOZ
Protein Properties Length: 604aa    MW: 66355.2 Da    PI: 6.0999
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G111696_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ393.16.9e-1212674841217
                VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwn 91 
                        p+ps++lgpkcalwdc rpa g+e+  dyc+ +ha laln+ gl+g++pv+rp+gidlkdg+lfaal akvqgk+vgip+c gaat+kspwn
  GRMZM2G111696_P01 267 PSPSQYLGPKCALWDCGRPAGGTEDSGDYCNPYHAGLALNDdGLLGIRPVMRPRGIDLKDGPLFAALIAKVQGKNVGIPVCGGAATSKSPWN 358
                        89**************************************9799************************************************ PP

                VOZ  92 aaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalaly 183
                        a+elfdlsllege++rewlffd+prrafesgnrkqrslpdy grgwhesrk vmk+f+glkrsyymdpqpsss+ewhl+eyein +dalaly
  GRMZM2G111696_P01 359 APELFDLSLLEGESLREWLFFDTPRRAFESGNRKQRSLPDYGGRGWHESRKLVMKDFAGLKRSYYMDPQPSSSHEWHLFEYEINASDALALY 450
                        ******************************************************************************************** PP

                VOZ 184 rlelklvdekks.akgkvskdsladlqkklgrlta 217
                        rle+k++d kk  ak+k++ ++l+++++++grlta
  GRMZM2G111696_P01 451 RLEYKSSDPKKGaAKSKLA-SPLNEIRQRMGRLTA 484
                        ********99962677775.79***********97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MAGDPAAGVG GNAHPASGSK SSRSSTRHRQ FRDRAKVRVD DLQEMFCGLQ SARKESRSAD  60
AAVLEEQVHQ MLREWRAELS VPSPASSLQN SQGNNREASD PPSDTLRLLQ LAVPEEEDDA  120
SSKLLVPPSR QTHEHGQDSR MANTDQQCEA IDGGTAPAQH SLGQGVDGDC GEVSSVANAM  180
FNHRMYYTDY ELNIDDFLCG DGYKINISGS NEDQFNNLHG IGQLGHQQFD LPLDLPPTHS  240
YADANNSEQN TGDVFVHMSD LLTTIWPSPS QYLGPKCALW DCGRPAGGTE DSGDYCNPYH  300
AGLALNDDGL LGIRPVMRPR GIDLKDGPLF AALIAKVQGK NVGIPVCGGA ATSKSPWNAP  360
ELFDLSLLEG ESLREWLFFD TPRRAFESGN RKQRSLPDYG GRGWHESRKL VMKDFAGLKR  420
SYYMDPQPSS SHEWHLFEYE INASDALALY RLEYKSSDPK KGAAKSKLAS PLNEIRQRMG  480
RLTADSPVEN KRTARSKPKA NQNQKDTNAN TRPHVNTPNQ VNAPNAYQTT QQVNQMAFLN  540
GNVVYGPHLP HSESVVYGPH LPHSENVVYG PHLPHSENVV YGPHLPQGYS AEGSSFFWNP  600
SDGT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.198550.0aerial organ| ear| embryo| endosperm| leaf| meristem| ovary| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G111696
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G111696_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0396290.0BT039629.1 Zea mays full-length cDNA clone ZM_BFc0035D15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105277.20.0expressed protein DH12
TrEMBLB4FR910.0B4FR91_MAIZE; Transcription factor VOZ1
STRINGGRMZM2G111696_P010.0(Zea mays)
STRINGGRMZM2G158717_P030.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Representative plantOGRP23271335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-133vascular plant one zinc finger protein