PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G110295_P01
Common NameLOC103644154, Zm.99654
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GATA
Protein Properties Length: 372aa    MW: 38400.4 Da    PI: 7.7046
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G110295_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.51.6e-17275309135
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                        C++C + +Tp+WR gp g+ktLCnaCG+++++ +l
  GRMZM2G110295_P01 275 CTHCASETTPQWRTGPLGPKTLCNACGVRFKSGRL 309
                        *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.7E-16269319IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.5E-13273307IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.556273305IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.18E-14273333No hitNo description
CDDcd002021.22E-13274321No hitNo description
PROSITE patternPS003440275300IPR000679Zinc finger, GATA-type
PfamPF003202.2E-15275309IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MASEWEMAAM GVELGMGMGG TYHHNASSIT TAPTSSHHSG GAGYSAAHHH HYYGMPPVGG  60
DATAMRVDDL LENLDLSTGA GAHEFFPTAA AANKGHHHSG GAMVGEPSPT ANSSDHQTSL  120
LSFADEFYIP SEEAAELEWL SKFVDDSYSD MPNYSSATHA AMAAAAAAAA AAANTAGTRA  180
GGTSGGQDSC ATAAPGRGAR SKRSSRAAAA AWHSLVPRPP SQPSPSTSCS SSDFTPASTN  240
NKPARPSNGG SRGRKSPGPA GEVVAVGVEG GVRRCTHCAS ETTPQWRTGP LGPKTLCNAC  300
GVRFKSGRLV PEYRPASSPT FVLTQHSNSH RKVMELRRQK ELVLIRGTHR DASAAAAGSA  360
GPELMFRDYG VC
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G110295
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G110295_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9537050.0EU953705.1 Zea mays clone 1444524 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001333895.10.0GATA transcription factor 2-like
TrEMBLA0A317YIL70.0A0A317YIL7_MAIZE; GATA transcription factor
STRINGGRMZM2G110295_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46212955
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.14e-44GATA transcription factor 2