PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G109879_P01
Common NameABI28, LOC103646788, Zm.26595
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family B3
Protein Properties Length: 552aa    MW: 61859.6 Da    PI: 10.4454
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G109879_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.31.2e-12381112699
                        T.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                 B3  26 h.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                        +     g+  +e+ t  + ++ g++W+v++   + + +  l++GW eF  a+g+  g fvv++++g  ++ l+vkvf++
  GRMZM2G109879_P01  38 CfdageGEGAPEP-TALVVSPFGKVWRVEV--VRDGHGASLGRGWAEFLAAHGVGIGWFVVLRYEG--GGALTVKVFDT 111
                        2466652233355.788899**********..77777788***********************987..6678*****97 PP

2B339.97.5e-13145228996
                        HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                 B3   9 dvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                        ++l+++ ++lp +f++++ +++  +s+  ++ ++  + W+v+l  ++ ++++++t+GW++F + +g+k g+++++k++g++ f  ++k+
  GRMZM2G109879_P01 145 SNLSEK-MMLPARFVKDYvSEECLNSRIAIIFSPIAKFWRVEL--KNDQSGIFFTGGWSQFLDFHGIKNGEVLLLKYEGNMVF--KFKA 228
                        455554.9**********855556777888889**********..999999****************************9999..5554 PP

3B355.31.2e-17301384186
                        EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                        ++k+ ++ ++l++  l l+ kf++++g   ++++tl+  + s rsW+v+ +   k  ry+++ GWk+F+++n+Lk+gD ++F  ++
  GRMZM2G109879_P01 301 WIKKRINTYALEQF-LALSVKFCNSIGFRMACTITLKTATNSTRSWQVRGT-AYKWHRYIIGVGWKSFCQDNRLKAGDLCTFNIIE 384
                        68999999999998.***********99999*99999999999*******3.344456************************9765 PP

4B352.49.5e-17462540686
                        ..-HHHHTT-EE--HHH.HTT---..--SEEEEEE..TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                 B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltled..esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                        +++++ + +rl+l   f++++++  +++  ++l++   s+ sW+v    ++k+g+y+++ GWk+F+ +n++k+gD+++F +++
  GRMZM2G109879_P01 462 MNASTIR-NRLCLAPAFCNQIELRRRCE--IVLKTsiNSNHSWRVGG-LSQKKGSYIIGPGWKKFCTENRVKVGDVCTFNVIE 540
                        3455554.67************998885..6666644788******9.6888889************************9775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.08E-1418114IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.8E-1318113IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.5E-618112IPR003340B3 DNA binding domain
CDDcd100177.92E-1018110No hitNo description
PfamPF023625.8E-1030111IPR003340B3 DNA binding domain
PROSITE profilePS508639.96859112IPR003340B3 DNA binding domain
PROSITE profilePS5086311.448136232IPR003340B3 DNA binding domain
CDDcd100179.25E-11137229No hitNo description
Gene3DG3DSA:2.40.330.103.2E-15139234IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.2E-13139232IPR003340B3 DNA binding domain
SuperFamilySSF1019361.16E-16140238IPR015300DNA-binding pseudobarrel domain
PfamPF023622.4E-10144226IPR003340B3 DNA binding domain
PROSITE profilePS5086311.702300396IPR003340B3 DNA binding domain
SuperFamilySSF1019366.08E-16300394IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.6E-18302395IPR015300DNA-binding pseudobarrel domain
PfamPF023624.2E-13302384IPR003340B3 DNA binding domain
SMARTSM010191.1E-5302396IPR003340B3 DNA binding domain
CDDcd100176.75E-10314380No hitNo description
SuperFamilySSF1019361.94E-15455550IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.0E-17456550IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0012458552IPR003340B3 DNA binding domain
CDDcd100177.33E-9458536No hitNo description
PfamPF023625.1E-13464546IPR003340B3 DNA binding domain
PROSITE profilePS5086310.405488552IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MPLPSDSGSG ARAMSKQFKV LLPTSFHKLR ISDELAGCFD AGEGEGAPEP TALVVSPFGK  60
VWRVEVVRDG HGASLGRGWA EFLAAHGVGI GWFVVLRYEG GGALTVKVFD TSLCIKEFGA  120
PAAVMPSKSC KSIFCKPQFI RIFHSNLSEK MMLPARFVKD YVSEECLNSR IAIIFSPIAK  180
FWRVELKNDQ SGIFFTGGWS QFLDFHGIKN GEVLLLKYEG NMVFKFKAFG LSGCQKDFKN  240
QNAGIQLNTK KQQETPPIRK RKSNDEKSSS EENKRLKTPV TSPSPSDPSL EKPYQIGTSS  300
WIKKRINTYA LEQFLALSVK FCNSIGFRMA CTITLKTATN STRSWQVRGT AYKWHRYIIG  360
VGWKSFCQDN RLKAGDLCTF NIIETTLWHV TITRSALAAD TFNKQKKPPC SSSRDKKGSS  420
SREGAKRPKP SMAHFSKVQV PPSYARRCAY DVGPPPWIRK QMNASTIRNR LCLAPAFCNQ  480
IELRRRCEIV LKTSINSNHS WRVGGLSQKK GSYIIGPGWK KFCTENRVKV GDVCTFNVIE  540
TQLWHVVITR RC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.265950.0ear| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G109879
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G109879_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9433830.0EU943383.1 Zea mays clone 1616277 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669670.10.0PREDICTED: putative B3 domain-containing protein Os04g0347400
TrEMBLA0A060D1G20.0A0A060D1G2_MAIZE; ABI3VP1 transcription factor (Fragment)
STRINGGRMZM2G109879_P020.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-10B3 family protein