PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G109869_P01
Common NameGRAS52, LOC103646038, Zm.19572
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 623aa    MW: 65571 Da    PI: 6.5741
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G109869_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS300.73.6e-922556232374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        ++lL e+A a+++g++e+a a La l+  a+++gd+ qRl+a+++ AL++r+a      +++ p++  ++  s+e+ a  +l++++sP++++
  GRMZM2G109869_P01 255 RQLLSEAAVAIADGHHEAAAAHLAALKRAANQHGDAEQRLIAMMVAALSSRIAP-----AASAPSQLLADLCSVEQRAGSQLLQDLSPCFRV 341
                        689***************************************************.....4455555555555888888889*********** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvl 181
                        +  +a  aI+eav  ++++H +Dfd+s + Q +aL+q La+R+ +  sl++T+v +p+s      + +l +++erL+k+Ae+ gv+ +f+v 
  GRMZM2G109869_P01 342 ALHAASAAIVEAVGDHRAIHLVDFDVSFP-QHAALIQYLADRRVQGRSLKVTAVTDPSSPftqsLTASLPAIEERLKKLAERAGVEYRFTV- 431
                        ****************************8.99************************99888877788999********************9. PP

               GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                        v+ r ++l+ ++L ++pgEa+aVnl+++l +++desvs +++rde+L+ v+ l P+vv++veqe+++n++++++rf++a+ +y a+++sl+a
  GRMZM2G109869_P01 432 VSCRAAELDASRLCCEPGEAVAVNLAFALSHVPDESVSPANPRDELLRRVRALGPQVVTLVEQELNTNTAPLAARFTDACAHYGAILESLDA 523
                        7999**************************************************************************************** PP

               GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq.aklllrkvksdgyrveeesgslvlgWkd 364
                        +l+re  e++  E++ l++++ n+v   g +r er+e ++kWr+r+++aGF+pv+l++++a++ + + + +v+  g++v+ e+g l ++W++
  GRMZM2G109869_P01 524 TLAREIAEKARAEAA-LSKKAANAVGRDGPDRLERCEVFGKWRARFGMAGFRPVSLGSSIAEElVGARVGHVP-PGFTVKAENGVLRFCWMG 613
                        **************9.****************************************99988772456666666.9***************** PP

               GRAS 365 rpLvsvSaWr 374
                        r+++++SaWr
  GRMZM2G109869_P01 614 RAVTVASAWR 623
                        *********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.611228603IPR005202Transcription factor GRAS
PfamPF035141.2E-89255623IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 623 aa     Download sequence    Send to blast
MEPGAPWRDP RQGYSYGVGS AMQLQLQLQQ RADAAAGGGV LKRSLGELER WQHHQQQQVA  60
AQQALYLRAV RQRTAAAVDI AALLGGTPAQ PLVLPGSSFG GGLASPSSTL SSSLTTASRA  120
AVPLMQPQLQ RQVPLTTSSP QTQPFGLSTA PLPQPSVSSE LFILQELEKQ LLDDDDDDEP  180
VAAMSGTGSA VTNSEWEETI QQLSSIAAAP SPGLPAAATP NNNNNNVGMT RSPSNSSTAS  240
SSASCSPPTP GAASRQLLSE AAVAIADGHH EAAAAHLAAL KRAANQHGDA EQRLIAMMVA  300
ALSSRIAPAA SAPSQLLADL CSVEQRAGSQ LLQDLSPCFR VALHAASAAI VEAVGDHRAI  360
HLVDFDVSFP QHAALIQYLA DRRVQGRSLK VTAVTDPSSP FTQSLTASLP AIEERLKKLA  420
ERAGVEYRFT VVSCRAAELD ASRLCCEPGE AVAVNLAFAL SHVPDESVSP ANPRDELLRR  480
VRALGPQVVT LVEQELNTNT APLAARFTDA CAHYGAILES LDATLAREIA EKARAEAALS  540
KKAANAVGRD GPDRLERCEV FGKWRARFGM AGFRPVSLGS SIAEELVGAR VGHVPPGFTV  600
KAENGVLRFC WMGRAVTVAS AWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3927362322375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.195720.0ear| endosperm| meristem| ovary| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G109869
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G109869_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7279750.0KJ727975.1 Zea mays clone pUT6089 GRAS transcription factor (GRAS52) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008668998.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A060CY610.0A0A060CY61_MAIZE; GRAS transcription factor (Fragment)
STRINGGRMZM2G109869_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7599918
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.15e-74SCARECROW-like 8