PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G109509_P01
Common NameZm.24436
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Nin-like
Protein Properties Length: 953aa    MW: 106232 Da    PI: 5.7934
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G109509_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.62.5e-28627677252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek++sle+l+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  GRMZM2G109509_P01 627 EKTVSLEELRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 677
                        799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.995616697IPR003035RWP-RK domain
PfamPF020424.6E-26629677IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2402.9E-23845930No hitNo description
SuperFamilySSF542771.3E-21846930No hitNo description
SMARTSM006661.4E-22848931IPR000270PB1 domain
PROSITE profilePS5174520.317848931IPR000270PB1 domain
PfamPF005646.0E-16849930IPR000270PB1 domain
CDDcd064073.63E-38849929No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 953 aa     Download sequence    Send to blast
MEQAPQTHGG GGLLACGVME DVAVGDLDLM EELFMAAPGF DFSDFSQPGA GGESPGVCFS  60
PLFDICSTTT TATPPPPPPS GDDNRDQPTP PRRGWVFQPR LEVDATVKER LRRALERIAS  120
LSQTQPGELL AQVWVPTVIG DRQVLTTCGQ PFWLDCRNER LANYRTVSMK YQFSADETAR  180
TDLGMPGRVF VGRVPEWTPD VRYFSTEEYP RVHHAQYFDI RGSVALPIFE PRSRVCLGVV  240
ELVMTTEKVN YNAEIQNICS ALKLCRLLCR YTLNLFDEMP LGKDVITTGH ANPRSNQSFH  300
LTLFGDVLVS VTDTSYRAII PEIVDVLRTV CETHKLPLAQ TWIPCICQAK RGSRHTDEKL  360
KYCVSTLDEA CYVRDLNVNG FHEACSEHHL FRGEGVVGRA FATNEPCFSE DITASSKIQY  420
PLSHHAKLFS LRAAVAIRLR SISTGSLDYV LEFFLPVDCI EIEEQRAMLN SLSITIQQTC  480
YTLRVVSLKE LVDEGSIETS ALTPPEYDKS MHENIDEVCS GIGVPARTAS LETSEEVSSW  540
IASLVCAQNK GVKEMDGDLP FGFSKQEDEG FSVTAGWHTS PVIEPEGSIF SGFKQHEEYK  600
VKEVTCLRDP SSSNLEKTVE KRRTKMEKTV SLEELRKHFA GSLKEAAKNL GVCPTTLKRI  660
CRQHGINRWP SRKIKKVGHS LKKLQMVIDS VHGSEGTVQL SSLYENFTKT TWSERELQGD  720
ATYPLSEEKG PLEPSVPDRY CEGRFTSHTS GSNSLSPSCS QSSNSSHGCS SGSKSQQHVS  780
APQLAVKKEV FMEENQSSTL LKAASHAELQ MLPEERLVTL PRSHSQVLLS EQKPVENITG  840
MQMSKPDSLK IKAMYGEERC IFRLQPSWGF EKLKEEILKR FGIAREVYVD LKYLDDESEW  900
VLLTCNADLL ECIDVYKSSS TQTVRILVHS SDQIGEKVIV GVPCQLLGLV CMQ
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G109509
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G109509_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001337202.10.0uncharacterized protein LOC100278991
RefseqNP_001337203.10.0uncharacterized protein LOC100278991
RefseqXP_023157659.10.0uncharacterized protein LOC100278991 isoform X2
RefseqXP_023157660.10.0uncharacterized protein LOC100278991 isoform X2
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A1D6JMR30.0A0A1D6JMR3_MAIZE; Protein NLP2
TrEMBLA0A317YCC00.0A0A317YCC0_MAIZE; Protein NLP1
STRINGGRMZM2G109509_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]