PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G108933_P01
Common NameHB94, LOC103651027, wox2A, Zm.99579
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family WOX
Protein Properties Length: 324aa    MW: 34810.7 Da    PI: 9.3962
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G108933_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-194099357
                       --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        R+++tkeq+ +Le l+e   r+psae++++++ +l     ++ ++V++WFqN++a++++
  GRMZM2G108933_P01 40 ARWNPTKEQVAVLEGLYEHgLRTPSAEQIQQITGRLrehgAIEGKNVFYWFQNHKARQRQ 99
                       7*****************99**************************************96 PP

2Wus_type_Homeobox110.68.5e-3639101365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+Pt+eQ+ +Le ly++GlrtP++e+iq+it +L+e+G+ie+kNVfyWFQN+kaR+rq+q
  GRMZM2G108933_P01  39 NARWNPTKEQVAVLEGLYEHGLRTPSAEQIQQITGRLREHGAIEGKNVFYWFQNHKARQRQRQ 101
                        78***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.34935100IPR001356Homeobox domain
SMARTSM003893.0E-537104IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.7E-74099IPR009057Homeodomain-like
SuperFamilySSF466893.02E-1240107IPR009057Homeodomain-like
PfamPF000463.7E-174099IPR001356Homeobox domain
CDDcd000862.32E-541101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
METPQQQSAA AAAAAAHGQD DGGSPPMSPA SAAAAALANA RWNPTKEQVA VLEGLYEHGL  60
RTPSAEQIQQ ITGRLREHGA IEGKNVFYWF QNHKARQRQR QKQDSFAYFS RLLRRPPPLP  120
VLSMPPAPPY HHARVPAPPA IPMPMAPPPP AACNDNGGAR VIYRNPFYVA APQAPPANAA  180
YYYPQPQQQQ QQQVTVMYQY PRMEVAGQDK MMTRAAAHQQ QQHNGAGQQP GRAGHPSRET  240
LQLFPLQPTF VLRHDKGRAA NGSNNDSLTS TSTATATATA TATASASISE DSDGLESGSS  300
GKGVEEAPAL PFYDFFGLQS SGGR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.995790.0endosperm| pollen
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G108933
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G108933_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9540620.0EU954062.1 Zea mays clone 1453569 homeobox domain containing protein mRNA, complete cds.
GenBankBT0370090.0BT037009.1 Zea mays full-length cDNA clone ZM_BFb0151I01 mRNA, complete cds.
GenBankAM4902350.0AM490235.1 Zea mays mRNA for putative wuschel homeobox protein (wox2A gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001306689.10.0WUSCHEL-related homeobox 5
SwissprotA2WWU71e-48WOX5_ORYSI; WUSCHEL-related homeobox 5
SwissprotQ8LR861e-48WOX5_ORYSJ; WUSCHEL-related homeobox 5
TrEMBLA8Y7V60.0A8Y7V6_MAIZE; HB transcription factor
STRINGGRMZM2G108933_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP85821116
MonocotsOGMP75093548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.16e-34WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Nardmann J,Werr W
    The shoot stem cell niche in angiosperms: expression patterns of WUS orthologues in rice and maize imply major modifications in the course of mono- and dicot evolution.
    Mol. Biol. Evol., 2006. 23(12): p. 2492-504
    [PMID:16987950]
  2. Nardmann J,Zimmermann R,Durantini D,Kranz E,Werr W
    WOX gene phylogeny in Poaceae: a comparative approach addressing leaf and embryo development.
    Mol. Biol. Evol., 2007. 24(11): p. 2474-84
    [PMID:17768306]
  3. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]