PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G108865_P01
Common NameDOF25, Zm.14936
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 371aa    MW: 38032 Da    PI: 9.1322
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G108865_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.27.4e-3878135360
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                        ++ l+cprC+s+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk + 
  GRMZM2G108865_P01  78 QTPLRCPRCNSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKPRP 135
                        66789**************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.3E-3180134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.09681135IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-2781132IPR003851Zinc finger, Dof-type
PROSITE patternPS01361083119IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MIQELLGGAA MDQLKSVNES LPLLLHSVIS NPSPTSSSST SSRSSAQQHQ QQRSTSATSS  60
PQAGQQQQQQ GQGQGAEQTP LRCPRCNSSN TKFCYYNNYN LTQPRHFCKT CRRYWTKGGA  120
LRNVPIGGGC RKPRPMPTPV TKPAVSCKAV GGAQSLGLGV GLGMGAGPGP WASSQQAAAA  180
QLMALLNSAR SVQGGGGGNM HRLLGLDAVA HLPLHVLPGA GNNAGGTAPS FWPQAAPRVI  240
PAPPHMDSQL GMGPLGQHDV LSSLGLKLPP PSPSPAASYY SDQLHAVVSS AAGRGHEYET  300
AACATSLPCT TALTSLPPAA SSVSAALASA ATVGLDLPLV SLSAPEMQYW AGPAAMSVAW  360
PDLPTPNGAF P
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.149360.0ear| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G108865
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G108865_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269760.0KJ726976.1 Zea mays clone pUT3677 C2C2-DOF transcription factor (DOF25) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001144626.20.0uncharacterized protein LOC100277644
TrEMBLA0A060CZ340.0A0A060CZ34_MAIZE; C2C2-DOF transcription factor (Fragment)
STRINGGRMZM2G108865_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.11e-31Dof family protein