PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G106356_P01
Common NameGRAS82, LOC103652715, ZEAMMB73_148287
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 629aa    MW: 71509.2 Da    PI: 6.1865
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G106356_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS283.46.7e-872426132373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        ++l+++cA+ vs +++++a++lL+++ ++as++gd++qRla++ft++L+arl++++s l + l +++ s   ++e ++a +l++e++ + k+
  GRMZM2G106356_P01 242 RRLMISCAQEVSVNNHSRARELLKQIIQHASETGDATQRLAQCFTKGLEARLVGTGSLLWELLMAERPS---VVEFTKASNLYFEACCFNKV 330
                        7899**************************************************999999988888887...9******************* PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp.fefnvlv 182
                        +      +I++a+ g++++Hi+D++++ G QW++L+++LasR++  p+++iT++g p+++   +e++ee++ rL + A+e+g+p f+f++ +
  GRMZM2G106356_P01 331 ALSFSEMTIMQAMVGKNKLHIVDYGMQFGYQWVSLFRSLASREGALPEVKITAIGLPKPKsyPTENIEEIRCRLGRSAHEFGLPlFKFHA-I 421
                        ********************************************************9999999********************989****.6 PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         +++ed  +e+L+++ +E+l+Vn  ++  +l+de  s ++  +rd vL  + +++P+v++ +  ++++ ++sFl rf e l yy+alfd ++
  GRMZM2G106356_P01 422 KTNWEDACIEDLNLEADEVLVVNDLFSFSTLMDEGISFDDlsPRDIVLCNISKMRPHVFIQSVYNCSY-GSSFLSRFREMLFYYMALFDIFD 512
                        99*********************************99998889*************************.678******************** PP

               GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                        a++pres+ r+++E+++lgr++ n+++ceg + +er e++++W+ r ++aG+++++l+ ++++ ++ +++k++ + + + ++ ++l++gW++
  GRMZM2G106356_P01 513 ATIPRESKSRMVLEQVVLGRSALNALSCEGVDLVERPERYRQWHTRNQRAGLRQLSLKMSTVELVRDMVKKHHHKDFLISQDGQWLLQGWRG 604
                        *************************************************************************888**************** PP

               GRAS 365 rpLvsvSaW 373
                        r  ++ S W
  GRMZM2G106356_P01 605 RVHFAHSTW 613
                        ********* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.84215594IPR005202Transcription factor GRAS
PfamPF035142.3E-84242613IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MATTPEEFFS KGLMEQSPPS PPVFPDLLEK PNDSSEGQHH VPNEMMLSYV SHVLMEDNDF  60
DDKFSDHPAL LQVQQPFAQI LSSPSSGTDT GNREGCNEFL HEVNVDKSML SSALSKGTDA  120
AGTFLKGMEE ANVLLPKDNN FRRDELVNQT VRENSSHSGV KKRHSRDDHL QMEIRTRKAA  180
MTVIEEPQEN LANETLDEMM LLGYKECIRD MDKLRVTTDN NKVVKQNRNS KETRDNNVVD  240
IRRLMISCAQ EVSVNNHSRA RELLKQIIQH ASETGDATQR LAQCFTKGLE ARLVGTGSLL  300
WELLMAERPS VVEFTKASNL YFEACCFNKV ALSFSEMTIM QAMVGKNKLH IVDYGMQFGY  360
QWVSLFRSLA SREGALPEVK ITAIGLPKPK SYPTENIEEI RCRLGRSAHE FGLPLFKFHA  420
IKTNWEDACI EDLNLEADEV LVVNDLFSFS TLMDEGISFD DLSPRDIVLC NISKMRPHVF  480
IQSVYNCSYG SSFLSRFREM LFYYMALFDI FDATIPRESK SRMVLEQVVL GRSALNALSC  540
EGVDLVERPE RYRQWHTRNQ RAGLRQLSLK MSTVELVRDM VKKHHHKDFL ISQDGQWLLQ  600
GWRGRVHFAH STWVAADASS RGLGSSNAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-232456138374GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G106356
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G106356_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280040.0KJ728004.1 Zea mays clone pUT6135 GRAS transcription factor (GRAS82) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677893.10.0PREDICTED: scarecrow-like protein 33 isoform X3
RefseqXP_008677891.10.0PREDICTED: scarecrow-like protein 34 isoform X1
TrEMBLK7TQL60.0K7TQL6_MAIZE; GRAS transcription factor
STRINGGRMZM2G106356_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1080039
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-107GRAS family protein