PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G106336_P01
Common NameZEAMMB73_743046
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 569aa    MW: 64161.6 Da    PI: 5.6074
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G106336_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS262.91.1e-801865602373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        +++L++cA+a++++d++ a++lL+r++++as +gd++qRla++f+++L+ar+++++ ++   l  +  s    +e l+a++l+se++ ++++
  GRMZM2G106336_P01 186 RRVLTSCAQALAADDHATARELLKRIKQHASATGDTTQRLAHCFAKGLEARILGTGGRIWPLLVLEYPS---GVELLKAYSLYSEACCFITV 274
                        789***************************************************999999888888887...9******************* PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp.fefnvlv 182
                        +++     I++a++g++r+Hi+D++   G+QW+ Ll+ Las++++ p++ iT++++p++     e++e++g+rL + A+elg+p f+f++ v
  GRMZM2G106336_P01 275 TFIFSAMIIMQAMAGKSRLHIVDYGTRFGFQWAGLLRLLASKEGDLPEVEITAIARPTPIcyPGEQIEKVGSRLMQCAHELGLPsFKFHA-V 365
                        **********************************************************9999*********************66*****.6 PP

               GRAS 183 akrledlel...eeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                        +k++ed +    ++L+ + +E+l+V   ++   l++es+  +   +rd+vL  +++++P+v++ +  + ++ ++sFl rf e l y++a+fd
  GRMZM2G106336_P01 366 TKNWEDATCtmeDHLHRDADEVLVVIDLFSFSILMEESMFFDApsPRDTVLCNIRKMRPDVFIQSVVNRSY-GSSFLSRFREILFYCTAMFD 456
                        7777777541115699999**********9999999997554444*****************999988888.679***************** PP

               GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                        +l+a+lprese r + E+ +lg  + n ++ceg++ + r e++++W++r e+aG++++pl+ +++k +k  + k++ + + v ++ ++l++g
  GRMZM2G106336_P01 457 MLDATLPRESESRLVFEKLVLGCYAFNGISCEGSDLVLRPEKYRQWQARNERAGLRQLPLKPSIVKVVKDEVMKHYHKDFLVCQDGQWLLQG 548
                        ****************************************************************************888************* PP

               GRAS 362 WkdrpLvsvSaW 373
                        W++r L++ + W
  GRMZM2G106336_P01 549 WMGRVLTAHTTW 560
                        ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.292159541IPR005202Transcription factor GRAS
PfamPF035143.9E-78186560IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MSMATTPEEF FIKDLMEQPP LSPPVFLDLP HKPNASNEDR HHVPNNDMTL PYISRMLMED  60
DDDELGDHPA LLQVQQPFAE ILSSPPLVGN NTNNSEGPND FLHEGTYELL DQTEESNIIN  120
SRVNRAVMMT TNELEDRCAN EMVDKMILHA YETCIGGMER VTIDVEKRNR KRKAAAAARG  180
GVVDIRRVLT SCAQALAADD HATARELLKR IKQHASATGD TTQRLAHCFA KGLEARILGT  240
GGRIWPLLVL EYPSGVELLK AYSLYSEACC FITVTFIFSA MIIMQAMAGK SRLHIVDYGT  300
RFGFQWAGLL RLLASKEGDL PEVEITAIAR PTPICYPGEQ IEKVGSRLMQ CAHELGLPSF  360
KFHAVTKNWE DATCTMEDHL HRDADEVLVV IDLFSFSILM EESMFFDAPS PRDTVLCNIR  420
KMRPDVFIQS VVNRSYGSSF LSRFREILFY CTAMFDMLDA TLPRESESRL VFEKLVLGCY  480
AFNGISCEGS DLVLRPEKYR QWQARNERAG LRQLPLKPSI VKVVKDEVMK HYHKDFLVCQ  540
DGQWLLQGWM GRVLTAHTTW VANGDASSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-211855604374GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G106336
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G106336_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677894.10.0PREDICTED: scarecrow-like protein 9
TrEMBLK7TYB90.0K7TYB9_MAIZE; Uncharacterized protein
STRINGGRMZM2G106336_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1080039
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.12e-90SCARECROW-like 14