PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G106276_P01
Common NameLOC100284389, ZEAMMB73_950666
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 272aa    MW: 28026.6 Da    PI: 9.715
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G106276_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-1993147256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++k+q  +Lee+F+ +++++ +++  LA++lgL  rqV vWFqNrRa+ k
  GRMZM2G106276_P01  93 RKKLRLSKDQAAVLEECFKTHHTLTPKQKVALASSLGLRPRQVEVWFQNRRARTK 147
                        788899***********************************************98 PP

2HD-ZIP_I/II126.98.6e-4193181190
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                        +kk+rlsk+q+++LEe+F+++++L+p++Kv+la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL kev+eLr +
  GRMZM2G106276_P01  93 RKKLRLSKDQAAVLEECFKTHHTLTPKQKVALASSLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRWCEQLAEENRRLGKEVAELR-A 181
                        69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-1977143IPR009057Homeodomain-like
PROSITE profilePS5007116.60189149IPR001356Homeobox domain
SMARTSM003893.8E-1791153IPR001356Homeobox domain
SuperFamilySSF466892.65E-1892158IPR009057Homeodomain-like
PfamPF000466.8E-1793147IPR001356Homeobox domain
CDDcd000866.10E-1593150No hitNo description
PRINTSPR000311.6E-5120129IPR000047Helix-turn-helix motif
PROSITE patternPS000270124147IPR017970Homeobox, conserved site
PRINTSPR000311.6E-5129145IPR000047Helix-turn-helix motif
PfamPF021837.7E-11149182IPR003106Leucine zipper, homeobox-associated
SMARTSM003407.9E-21149192IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated