PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G106276_P01
Common NameLOC100284389, ZEAMMB73_950666
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 272aa    MW: 28026.6 Da    PI: 9.715
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G106276_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-1993147256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++k+q  +Lee+F+ +++++ +++  LA++lgL  rqV vWFqNrRa+ k
  GRMZM2G106276_P01  93 RKKLRLSKDQAAVLEECFKTHHTLTPKQKVALASSLGLRPRQVEVWFQNRRARTK 147
                        788899***********************************************98 PP

2HD-ZIP_I/II126.98.6e-4193181190
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                        +kk+rlsk+q+++LEe+F+++++L+p++Kv+la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL kev+eLr +
  GRMZM2G106276_P01  93 RKKLRLSKDQAAVLEECFKTHHTLTPKQKVALASSLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRWCEQLAEENRRLGKEVAELR-A 181
                        69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-1977143IPR009057Homeodomain-like
PROSITE profilePS5007116.60189149IPR001356Homeobox domain
SMARTSM003893.8E-1791153IPR001356Homeobox domain
SuperFamilySSF466892.65E-1892158IPR009057Homeodomain-like
PfamPF000466.8E-1793147IPR001356Homeobox domain
CDDcd000866.10E-1593150No hitNo description
PRINTSPR000311.6E-5120129IPR000047Helix-turn-helix motif
PROSITE patternPS000270124147IPR017970Homeobox, conserved site
PRINTSPR000311.6E-5129145IPR000047Helix-turn-helix motif
PfamPF021837.7E-11149182IPR003106Leucine zipper, homeobox-associated
SMARTSM003407.9E-21149192IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MAPQSLDLGL SLGLGVAAFQ PSSFCHPGNA VVVPAAAERE ASPAAAEERE RRCSPAGSPV  60
SSGSGSGNKR GAAERSAGAG AGSGDEDDDG AARKKLRLSK DQAAVLEECF KTHHTLTPKQ  120
KVALASSLGL RPRQVEVWFQ NRRARTKLKQ TEVDCEYLKR WCEQLAEENR RLGKEVAELR  180
ALSAAPAAPL TTLTMCLSCR RVASSSPPSS SSSPNIPGAA AASGGSMASP AAAAATLPAH  240
RQFFCGFRDA GAAAAAYGTA SSGLAKPVRA AR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141149RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.215730.0cell culture| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G106276
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems and panicles. {ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G106276_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9681200.0EU968120.1 Zea mays clone 314746 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150756.11e-132uncharacterized protein LOC100284389
SwissprotA2Y9317e-67HOX28_ORYSI; Homeobox-leucine zipper protein HOX28
SwissprotQ5VPE57e-67HOX28_ORYSJ; Homeobox-leucine zipper protein HOX28
TrEMBLK7VB560.0K7VB56_MAIZE; Putative homeobox DNA-binding and leucine zipper domain family protein
STRINGGRMZM2G106276_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.17e-44homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]