PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G105834_P01
Common NameLOC103639392, ZEAMMB73_124057, Zm.31826
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 296aa    MW: 31560.5 Da    PI: 9.4165
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G105834_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.59.6e-18122176256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ ++tkeq + Le+ F+ +++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  GRMZM2G105834_P01 122 RKKLRLTKEQSKLLEDRFKDHSTLNPKQKIALAKQLKLRPRQVEVWFQNRRARTK 176
                        788899***********************************************98 PP

2HD-ZIP_I/II121.73.6e-39122212192
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        +kk+rl+keq+klLE+ F+ +++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+een+rL++e +eLr +lk
  GRMZM2G105834_P01 122 RKKLRLTKEQSKLLEDRFKDHSTLNPKQKIALAKQLKLRPRQVEVWFQNRRARTKLKQTEVDCELLKRCCESLSEENRRLQRELQELR-ALK 212
                        69*************************************************************************************9.666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-17113177IPR009057Homeodomain-like
SuperFamilySSF466895.01E-18116179IPR009057Homeodomain-like
PROSITE profilePS5007116.941118178IPR001356Homeobox domain
SMARTSM003893.6E-15120182IPR001356Homeobox domain
CDDcd000864.49E-14122179No hitNo description
PfamPF000465.1E-15122176IPR001356Homeobox domain
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
PfamPF021833.6E-10178213IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.9E-20178222IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MAQEDVHLDD AGLALGLSLG GGGGGGASAA ARHGTSRSRL STEAPRTLEP PSLTLSMPDE  60
ATATATGGSG GSGGAARSVS SRSVEGVKRE RVDDAEGERA SSTAAAARAG AGAEDDDDGS  120
TRKKLRLTKE QSKLLEDRFK DHSTLNPKQK IALAKQLKLR PRQVEVWFQN RRARTKLKQT  180
EVDCELLKRC CESLSEENRR LQRELQELRA LKQLAGPHPH QAPSSSPAAA TQGVPVPVPV  240
PPPLYVQMQM QLPMPAATLS LCPSCERLRG GPKAEPDRPQ AATHRFFNPF THSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120126TRKKLRL
2170178RRARTKLKQ
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G105834
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G105834_P01
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008660367.10.0homeobox-leucine zipper protein HOX19
SwissprotA2XE768e-88HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL48e-88HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLK7WFM40.0K7WFM4_MAIZE; Putative homeobox DNA-binding and leucine zipper domain family protein
STRINGGRMZM2G105834_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.18e-31HD-ZIP family protein