PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G105387_P02
Common NameLOC100282492, ZEAMMB73_698020, Zm.11627
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MIKC_MADS
Protein Properties Length: 257aa    MW: 28757 Da    PI: 8.7778
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G105387_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.86.8e-241056248
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                       r+en   rqvtf+kRr+g+lKKA ELSvLCda v +i+fs +gkly+
  GRMZM2G105387_P02 10 RVENPVHRQVTFCKRRAGLLKKARELSVLCDASVGIIVFSAHGKLYD 56
                       789******************************************97 PP

2K-box32.92.7e-12901591684
              K-box  16 slqqelakLkkeienLqreqRhllGedLe.sLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                          ++e + L++ei+ Lq+ +R + G+  +  +++ eL+ Le+ Le  + + Rs K++++ ++i+ l+ k 
  GRMZM2G105387_P02  90 DPKHETTVLQQEINLLQKGLRYIYGNRANeHMNVDELNALERYLEIWMYNTRSAKMQIMAQEIQALKSKA 159
                        55789999*****************998626************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-33160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-26177IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.156161IPR002100Transcription factor, MADS-box
CDDcd002657.54E-37279No hitNo description
PRINTSPR004046.8E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-221055IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.69388209IPR002487Transcription factor, K-box
PfamPF014863.5E-1491159IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006310anatomytassel floret
PO:0006340anatomyadult vascular leaf
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020126anatomytassel inflorescence
PO:0020136anatomyear inflorescence
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MARGKVQLRR VENPVHRQVT FCKRRAGLLK KARELSVLCD ASVGIIVFSA HGKLYDLATT  60
GTMEELIERY KAASAGEATT DGCGRHNRMD PKHETTVLQQ EINLLQKGLR YIYGNRANEH  120
MNVDELNALE RYLEIWMYNT RSAKMQIMAQ EIQALKSKAC QNPVHINSTK TRGFQHPFTS  180
LKVSACTQEG MLKAANEILQ EKIVEQSSLL DVGMVVADQQ NGRFSTVPLV EEVISSNPLT  240
VLSGYSSCRG SEMGYSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-15170169MEF2C
5f28_B4e-15170169MEF2C
5f28_C4e-15170169MEF2C
5f28_D4e-15170169MEF2C
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G105387
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaves and spikelets (rice flower). {ECO:0000269|Ref.7}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G105387_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0850010.0BT085001.1 Zea mays full-length cDNA clone ZM_BFb0224I24 mRNA, complete cds.
GenBankKJ7281890.0KJ728189.1 Zea mays clone pUT6462 MADS transcription factor (MADS32) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677250.10.0MADS-box transcription factor 26 isoform X2
SwissprotA2YQK91e-133MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G81e-133MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A1D6PX181e-174A0A1D6PX18_MAIZE; Agamous-like MADS-box protein AGL12
STRINGGRMZM2G105387_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-56AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]
  4. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]