PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G105335_P01
Common NameZEAMMB73_455004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRF
Protein Properties Length: 401aa    MW: 43203 Da    PI: 7.9791
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G105335_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.99.8e-2590133144
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                        d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  GRMZM2G105335_P01  90 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 133
                        79***************************************998 PP

2QLQ582.9e-201953236
                QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                       +FTa+Q+q+L++Q+l+yK+La+++P+P++L+ +++
  GRMZM2G105335_P01 19 PFTASQWQELEHQALIYKCLASGKPIPSYLMPPLR 53
                       9******************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.1E-111854IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.8141954IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.9E-141951IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.57390134IPR014977WRC domain
PfamPF088792.2E-2091133IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MMMMSSGRAG GGATAGRYPF TASQWQELEH QALIYKCLAS GKPIPSYLMP PLRRILDSAL  60
ATSPSLAYPP QPSLGWGCFG MGFTRKADED PEPGRCRRTD GKKWRCSKEA YPDSKYCEKH  120
MHRGKNRSRK PVEMSLATPA PAPAPAAATT ATATSSPAPS YHRPAHDATP SPYHALYGGG  180
GGGGGSPYSA SARPGATGGG GAYHHAQHVS PFHLHLETTH PHPPPPYNYS ADQRDYAYGH  240
AAAKEVGEHA FFSDGAGERV DRQAAAGQWQ FRQLGVETKP GPTPLFPVAG YGHGAASPYG  300
VEMGKDDDEQ EERRRQHCFV LGADLRLERP SSGHGHGHDH DDAAAAQKPL RPFFDEWPHQ  360
KGDKAGSWMG LDGETQLSMS IPMAATDLPV TSRFRNGGHY E
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G105335
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G105335_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5158420.0EF515842.1 Zea mays putative growth-regulating factor 3 (GRF3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008676418.10.0putative growth-regulating factor 3 isoform X1
SwissprotQ6AWY81e-158GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLK7U1V30.0K7U1V3_MAIZE; Growth-regulating factor 6
STRINGGRMZM2G105335_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.16e-47growth-regulating factor 5