PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G098813_P04
Common NameZEAMMB73_199317, zfl1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family LFY
Protein Properties Length: 268aa    MW: 29444.6 Da    PI: 10.1322
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G098813_P04genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY392.65e-12018256157386
            FLO_LFY 157 ekeaagsgge.glgeaelvaaeekkseeekkkaskk.kqkrkkkkelkse........ededeeeeededeegsgedgeerqrehPfivtep 238
                        e++aa+sgg+  +gea+  +++++  ++ kk    + k k+ ++k+ + +        +d de    +e++e+s+ ++ erqrehPf+vtep
  GRMZM2G098813_P04  18 ERDAAASGGGmAEGEAGRRMVTTTAGKKGKKGVVGTrKGKKARRKK-ELRplnvlddeNDGDEYGGGSESTESSAGGSGERQREHPFVVTEP 108
                        4455555443034444444444332222222222221222222222.12234554322222222223334444555556************* PP

            FLO_LFY 239 gevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkerg 330
                        gevar+kknGLDYLf+LyeqCr fLlqvq+iak  G+k+Ptkvtnqvfrya+k+gasyinkPkmrhYvhCYalhcLdeeasnalrra+k rg
  GRMZM2G098813_P04 109 GEVARAKKNGLDYLFHLYEQCRVFLLQVQSIAKLGGHKSPTKVTNQVFRYANKCGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKSRG 200
                        ******************************************************************************************** PP

            FLO_LFY 331 envGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                        envGawrqacy+plv+iaar+g+didavf+ahprL++WYvPt+LrqLCh++r +++
  GRMZM2G098813_P04 201 ENVGAWRQACYAPLVEIAARHGFDIDAVFAAHPRLAVWYVPTRLRQLCHQARGSHA 256
                        ****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016986.7E-13015256IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006340anatomyadult vascular leaf
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MLLALVRSYR KLAALSDERD AAASGGGMAE GEAGRRMVTT TAGKKGKKGV VGTRKGKKAR  60
RKKELRPLNV LDDENDGDEY GGGSESTESS AGGSGERQRE HPFVVTEPGE VARAKKNGLD  120
YLFHLYEQCR VFLLQVQSIA KLGGHKSPTK VTNQVFRYAN KCGASYINKP KMRHYVHCYA  180
LHCLDEEASN ALRRAYKSRG ENVGAWRQAC YAPLVEIAAR HGFDIDAVFA AHPRLAVWYV  240
PTRLRQLCHQ ARGSHAHAAA GLPPPPMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-100962544162PROTEIN LEAFY
2vy2_A1e-100962544162PROTEIN LEAFY
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.67880.0ear| meristem| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G098813
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G098813_P04
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1798820.0AY179882.1 Zea mays cultivar A632 floricaula/leafy-like 1 (fl1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105201.10.0zea floricaula/leafy 1
SwissprotQ0JAI11e-126FL_ORYSJ; Probable transcription factor FL
TrEMBLK7TS520.0K7TS52_MAIZE; Uncharacterized protein
STRINGGRMZM2G098813_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.13e-98floral meristem identity control protein LEAFY (LFY)