PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G098813_P02
Common NameZEAMMB73_199317, zfl1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family LFY
Protein Properties Length: 315aa    MW: 34538.2 Da    PI: 9.7313
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G098813_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY464.85.7e-142130381386
            FLO_LFY  81 mkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeae 172
                        m+++eldd+m++l+ +fr+d+l+Ger+G++aa+raer r+++      r      +  ++lda+sqe+ls+e+++        gg+ +gea+
  GRMZM2G098813_P02   1 MTERELDDMMAALAGLFRWDVLLGERFGLRAALRAERGRVMSLG---ARC----FHAGSTLDAASQEALSDERDAAASG----GGMAEGEAG 81 
                        9****************************************966...333....245678************8865333....222223333 PP

            FLO_LFY 173 lvaaeekkseeekkka.skk...kqkrkkkkelkse........ededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYL 252
                          +++++  ++ kk    ++   k++rkk+     +        +d de    +e++e+s+ ++ erqrehPf+vtepgevar+kknGLDYL
  GRMZM2G098813_P02  82 RRMVTTTAGKKGKKGVvGTRkgkKARRKKEL----RplnvlddeNDGDEYGGGSESTESSAGGSGERQREHPFVVTEPGEVARAKKNGLDYL 169
                        3333322222222221011101122222222....123343322222222223334444555556*************************** PP

            FLO_LFY 253 fdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykpl 344
                        f+LyeqCr fLlqvq+iak  G+k+Ptkvtnqvfrya+k+gasyinkPkmrhYvhCYalhcLdeeasnalrra+k rgenvGawrqacy+pl
  GRMZM2G098813_P02 170 FHLYEQCRVFLLQVQSIAKLGGHKSPTKVTNQVFRYANKCGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKSRGENVGAWRQACYAPL 261
                        ******************************************************************************************** PP

            FLO_LFY 345 vaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                        v+iaar+g+didavf+ahprL++WYvPt+LrqLCh++r +++
  GRMZM2G098813_P02 262 VEIAARHGFDIDAVFAAHPRLAVWYVPTRLRQLCHQARGSHA 303
                        **************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.6E-1581303IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MTERELDDMM AALAGLFRWD VLLGERFGLR AALRAERGRV MSLGARCFHA GSTLDAASQE  60
ALSDERDAAA SGGGMAEGEA GRRMVTTTAG KKGKKGVVGT RKGKKARRKK ELRPLNVLDD  120
ENDGDEYGGG SESTESSAGG SGERQREHPF VVTEPGEVAR AKKNGLDYLF HLYEQCRVFL  180
LQVQSIAKLG GHKSPTKVTN QVFRYANKCG ASYINKPKMR HYVHCYALHC LDEEASNALR  240
RAYKSRGENV GAWRQACYAP LVEIAARHGF DIDAVFAAHP RLAVWYVPTR LRQLCHQARG  300
SHAHAAAGLP PPPMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A2e-991433014162PROTEIN LEAFY
2vy2_A2e-991433014162PROTEIN LEAFY
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.67880.0ear| meristem| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G098813
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G098813_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1798820.0AY179882.1 Zea mays cultivar A632 floricaula/leafy-like 1 (fl1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105201.10.0zea floricaula/leafy 1
SwissprotQ0JAI11e-162FL_ORYSJ; Probable transcription factor FL
TrEMBLK7ULL30.0K7ULL3_MAIZE; Uncharacterized protein
STRINGGRMZM2G098813_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-97floral meristem identity control protein LEAFY (LFY)