PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G096610_P01
Common NameLOC103641503, TCP40, ZEAMMB73_733228, Zm.50462
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family TCP
Protein Properties Length: 176aa    MW: 18325.7 Da    PI: 7.7884
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G096610_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP101.51.5e-3158124773
                TCP   7 rhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                        ++ ++h+kv gR+RRvR++a +aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt+ +++++ 
  GRMZM2G096610_P01  58 SSADRHAKVAGRGRRVRIPAMVAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTTEEAP 124
                        678********************************************************54444222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.8E-2858155IPR005333Transcription factor, TCP
PROSITE profilePS5136924.4759113IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MSSSSSDLVL YNLVPAPQTL NPPPPHVTAA PDLSISTAVA AAPEPVIRGR VRRTVGSSSA  60
DRHAKVAGRG RRVRIPAMVA ARVFQLTREL GHRTDGETIE WLLRQAEPSI IAATGTGVTT  120
EEAPSSLVPV SSIASSVSLT PVPYYTALLM QPPPTANESP VASASVSGTV AEENNN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.901790.0shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G096610
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G096610_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269990.0KJ726999.1 Zea mays clone pUT3971 TCP transcription factor (TCP40) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008663070.11e-121PREDICTED: transcription factor PCF1-like
SwissprotO238751e-57PCF1_ORYSJ; Transcription factor PCF1
TrEMBLK7TSC81e-121K7TSC8_MAIZE; TCP transcription factor
STRINGGRMZM2G096610_P011e-120(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9221459
MonocotsOGMP141722627
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72010.11e-26TCP family protein