PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G093725_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 224aa    MW: 23026.6 Da    PI: 10.7817
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G093725_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.1e-3984144262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +e  lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrn+PvGgg+r+nk+++
  GRMZM2G093725_P01  84 PEPGLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNIPVGGGCRRNKRTK 144
                        56789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3668138IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3288142IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.54488142IPR003851Zinc finger, Dof-type
PROSITE patternPS01361090126IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MATLSGTGGG GGGNVDAHAH HHQLPSMPPP ARVGALMAPR PNMAAVVAAS GGSTSDGSGP  60
TGGGSVIRSG SMTERARLAK IPQPEPGLKC PRCESTNTKF CYFNNYSLSQ PRHFCKTCRR  120
YWTRGGALRN IPVGGGCRRN KRTKSSNSSS ATSASRASGT SSSTSSTATG GNSAASIKLP  180
HQGHGGQLPF LASLHHPFTD GDHHYNTGAS RLGFPGLSSL DPMD
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G093725
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G093725_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0625050.0BT062505.1 Zea mays full-length cDNA clone ZM_BFb0307A23 mRNA, complete cds.
GenBankBT0674170.0BT067417.1 Zea mays full-length cDNA clone ZM_BFc0042G08 mRNA, complete cds.
GenBankEU9565990.0EU956599.1 Zea mays clone 1567744 hypothetical protein mRNA, complete cds.
GenBankJX4284520.0JX428452.1 Zea mays subsp. mays clone pUT3046 DOF27 transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001143068.12e-89Dof zinc finger protein DOF3.6
RefseqXP_008669607.12e-89dof zinc finger protein DOF3.6 isoform X1
TrEMBLA0A1D6L9X91e-160A0A1D6L9X9_MAIZE; Dof zinc finger protein DOF3.6
STRINGGRMZM2G093725_P011e-161(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.17e-42DNA binding with one finger 2.4