PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G092609_P01
Common NamebZIP103, LOC100272272
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 320aa    MW: 34668.7 Da    PI: 6.7449
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G092609_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.11.6e-071872361463
                        HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1  14 ReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        R + +rsR RK+++i+eLe+ v++L++   +L+ ++++l ++  +l +e+
  GRMZM2G092609_P01 187 RRSGQRSRVRKLQYIAELERTVDSLQNIGADLAVRVSSLFQLHNALSMEN 236
                        67889****************************99999999998888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147037.65E-16186230No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-6187246No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MSRSPHLPPR CPPLGPQITR RDDSMFTQSC RFPSGDTFFS EPPCWLDDLL ADSGKAPKLP  60
PLRRACSDSD AILDALSTFE SPICRIEEGN QISGGEADDL LDAGEGGESG SVVEASCVYG  120
PNSPRQKSRL TTSESSMVNA VLENVPSNPL QYLSIDASSG MNGNVANGTA DTCDAFGHPD  180
QDKSFKRRSG QRSRVRKLQY IAELERTVDS LQNIGADLAV RVSSLFQLHN ALSMENKQLR  240
IQISSLQRAK LIKDGQTQAL KNEAERLKRM SARRSRSATA SCYDPGSFSF GADASSVSWQ  300
MPDMARLSLN GGSPRGSYGL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186192RRSGQRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.991020.0meristem| ovary| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G092609
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G092609_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0383830.0BT038383.1 Zea mays full-length cDNA clone ZM_BFb0229F13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140232.10.0uncharacterized protein LOC100272272
TrEMBLA0A3L6EMJ60.0A0A3L6EMJ6_MAIZE; Basic leucine zipper 6
TrEMBLB4FMP50.0B4FMP5_MAIZE; BZIP protein
STRINGGRMZM2G092609_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81372631
Representative plantOGRP973745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.28e-16bZIP family protein