PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G092214_P01
Common NameLOC100272415, TCP8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family TCP
Protein Properties Length: 324aa    MW: 34346.9 Da    PI: 6.8973
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G092214_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP123.81.9e-3896170276
                TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceae 76 
                        a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++t++WLlqqa+pai ++tgt++++as+  ++
  GRMZM2G092214_P01  96 APKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETVQWLLQQAEPAIVAATGTGTIPASALASV 170
                        789*****************************************************************9766222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.5E-31101181IPR005333Transcription factor, TCP
PROSITE profilePS5136928.039102156IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MDPKFPTPLA LNKTEPTTAT TTTTSTAQHH QLDPKDYQQQ TAQHQEQQQH HHHPHLQIQI  60
HQPPPPPQDG GGGVKEQQQL LQVVAQPGDR RQQALAPKRS SNKDRHTKVD GRGRRIRMPA  120
LCAARIFQLT RELGHKSDGE TVQWLLQQAE PAIVAATGTG TIPASALASV APSLPSPTSG  180
LARPHHHHPH HMWAPSAGFS SPSFLNSAGA GDGTGIGGIM QRMGVPAGLE LPGGGAAGGH  240
IGFAPMFAGH AAAMPGLELG LSQDGHIGVL AAQSISQFYH QVGAAAGGSG QMQHPHGHQH  300
HHHQQQEDGE DDREDGESDD ESGQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.55220.0meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G092214
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269|PubMed:12631321, ECO:0000269|PubMed:16123132}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00384DAPTransfer from AT3G27010Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G092214_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0386720.0BT038672.1 Zea mays full-length cDNA clone ZM_BFb0307K22 mRNA, complete cds.
GenBankBT0683480.0BT068348.1 Zea mays full-length cDNA clone ZM_BFb0130H19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001353444.10.0uncharacterized protein LOC100272415
SwissprotQ9LSD59e-55TCP20_ARATH; Transcription factor TCP20
TrEMBLB4FNI40.0B4FNI4_MAIZE; TCP transcription factor
STRINGGRMZM2G092214_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Representative plantOGRP9221459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.17e-40TCP family protein
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]
  2. Zhu P, et al.
    Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972
    [PMID:27708161]
  3. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  4. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  5. Guan P
    Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1697
    [PMID:29033968]
  6. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  7. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]
  8. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]