PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G089949_P01
Common NameDOF6, Zm.128918
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 383aa    MW: 41193.5 Da    PI: 8.9561
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G089949_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof104.65.7e-331481461
             zf-Dof 14 tntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                       ++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrk+k++
  GRMZM2G089949_P01  1 MDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKSKNA 48
                       69*******************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-21146IPR003851Zinc finger, Dof-type
PROSITE profilePS5088424.353147IPR003851Zinc finger, Dof-type
PfamPF027018.9E-26147IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MDTKFCYYNN YNVNQPRHFC KNCQRYWTAG GTMRNVPVGA GRRKSKNASL HYRQLLMAPD  60
CMLGPRVDIS KPVLPEGLAS SPPAPTQPAS RNGTVLKFGH EVPFCESMVS ALNIDEQNGN  120
SPGGPTARGE NREDNNNPGS GTPPYNGVPE TMAPVVGKNG APVHCNGVAP VPQYYLGTPF  180
MYPWNVGWSN VPVMVPGKSM PEPAPAPESC STSSAVWMNP PMMPGSRPPP SPAFPYPLVP  240
PGLWGCFSGW PATAWNVPWT RTNVCVSPPP PPPLSPSPSS NSSSCSGNGS PTLGKHSRDT  300
NPLREEKREK SLWVPKTLRI DDPDDAAKSS IWATLGIKPG DPGTFIKPFQ SKVESKGQRS  360
DAAQVLQANP AAMSRSQSFQ ESS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1289180.0meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G089949
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G089949_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277000.0KJ727700.1 Zea mays clone pUT5639 C2C2-DOF transcription factor (DOF6) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020405203.10.0uncharacterized LOC100275712 isoform X1
TrEMBLA0A1D6MQD30.0A0A1D6MQD3_MAIZE; Dof-type zinc finger DNA-binding family protein
STRINGGRMZM2G089949_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-31cycling DOF factor 2