PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G089850_P01
Common NameLOC100502239, Zm.34711
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 274aa    MW: 28046.1 Da    PI: 8.6696
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G089850_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.36.2e-3753109662
             zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         +cprC s++tkfCyynny++sqPr+fCk+CrryWtkGG+lrnvPvGgg+rk+ +ss
  GRMZM2G089850_P01  53 DPCPRCGSRDTKFCYYNNYNTSQPRHFCKSCRRYWTKGGSLRNVPVGGGTRKSGSSS 109
                        58**************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-215298IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.48153107IPR003851Zinc finger, Dof-type
PfamPF027012.8E-3154106IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105591IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0008018anatomytransition vascular leaf
PO:0009025anatomyvascular leaf
PO:0009066anatomyanther
PO:0020040anatomyleaf base
PO:0025142anatomyleaf tip
PO:0025541anatomybundle sheath cell
PO:0025589anatomyleaf lamina tip
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MQLSHTAPRM QEPGRRPVPP FAGVDLRRPR GYPAPAAKEA EEEPAPAPAP GGDPCPRCGS  60
RDTKFCYYNN YNTSQPRHFC KSCRRYWTKG GSLRNVPVGG GTRKSGSSSS ASASATPTST  120
GAAPKSPRSS KNSKRRRVGP APAPDPAPAT ATATADVANT APSTEAAAAT RAASEKPAAT  180
EPAAATGAAS EKPAATELAA AVVSTEKPPA AVGGFTDTST TVPEIGLADV CSGGVKELVP  240
DPGHFEWPSG CDLGSYWGTS VFADTDPALF LNLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133137KRRRV
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G089850
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G089850_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0875000.0BT087500.1 Zea mays full-length cDNA clone ZM_BFb0096C05 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001183645.10.0uncharacterized LOC100502239
TrEMBLC4J9K30.0C4J9K3_MAIZE; Uncharacterized protein
TrEMBLK0DCU50.0K0DCU5_MAIZE; DOF16 C2C2-DOF type transcription factor (Fragment)
STRINGGRMZM2G089850_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-23DOF zinc finger protein 1