PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G088309_P01
Common NameZmDL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family YABBY
Protein Properties Length: 205aa    MW: 23047.5 Da    PI: 8.4949
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G088309_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY1359.1e-4211471162
              YABBY   1 advfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesa 92 
                        +d++s+se++Cyv+C++Cnt+lav vP + l+ +vtv+CGhC +l    l+ +  ++   s  d+ l + +         +   n+ ++   
  GRMZM2G088309_P01   1 MDMVSQSEHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNNLSY--LSPRPPMVQPLSPTDHPLGPFQ--------CQGPCNDCRR--- 79 
                        57899*************************************99865..3333322222222222333222........2222233333... PP

              YABBY  93 stsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWah 162
                          +++    s +++e +pr+p v++PPek+ r Psaynrf++eeiqrika+ Pdi hreafs+aaknWa 
  GRMZM2G088309_P01  80 --NQPLPLASPSSTELSPRMPFVVKPPEKKHRLPSAYNRFMREEIQRIKAAKPDIPHREAFSMAAKNWAK 147
                        ..333333466778999***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.4E-466148IPR006780YABBY protein
SuperFamilySSF470952.36E-893149IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.1E-5102149IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MDMVSQSEHL CYVRCTYCNT VLAVGVPCKR LMDTVTVKCG HCNNLSYLSP RPPMVQPLSP  60
TDHPLGPFQC QGPCNDCRRN QPLPLASPSS TELSPRMPFV VKPPEKKHRL PSAYNRFMRE  120
EIQRIKAAKP DIPHREAFSM AAKNWAKCDP RCSTAASTET SNSAPAEPRV VPTPQLTEPR  180
FDLEDRAKGQ VIESFDIFKH IERSI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.12420.0ear| endosperm| meristem| shoot| silk| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G088309
Function -- GeneRIF ? help Back to Top
  1. Results suggest that DL-related genes are functionally conserved within the grass family.
    [PMID: 19556707]
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G088309_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9605560.0EU960556.1 Zea mays clone 226122 protein DROOPING LEAF mRNA, complete cds.
GenBankBT0611480.0BT061148.1 Zea mays full-length cDNA clone ZM_BFb0116A21 mRNA, complete cds.
GenBankAB4702700.0AB470270.1 Zea mays ZmDL1 mRNA for DL related protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001148730.11e-152protein DROOPING LEAF
SwissprotQ76EJ01e-112YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBLB6T6E11e-152B6T6E1_MAIZE; C2C2-YABBY transcription factor
STRINGGRMZM2G088309_P021e-149(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.11e-51YABBY family protein
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]
  2. Ishikawa M, et al.
    The spatial expression patterns of DROOPING LEAF orthologs suggest a conserved function in grasses.
    Genes Genet. Syst., 2009. 84(2): p. 137-46
    [PMID:19556707]