PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G085873_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family YABBY
Protein Properties Length: 160aa    MW: 18350.8 Da    PI: 9.8128
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G085873_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY173.41.4e-53113431170
              YABBY  31 lfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekee....sastsvssekl.senedeevprvppvir 117
                        ++++vtvrCGhCtsllsvnl+   q l+++++  +  +e    + kv++ ++++n+ ++     s++  +++ +l  + + +++ +    +r
  GRMZM2G085873_P01   1 MLNMVTVRCGHCTSLLSVNLRGLIQSLPVVQN--HYSQE----HFKVQNFSFTENYPEYAappsSSRYRMPT-MLsAKGDLDHMLH----VR 81 
                        5799*************************997..44444....44455555555544443000033333333.4413334444444....89 PP

              YABBY 118 PPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                         PekrqrvPsaynrfikeei+rika+nPdishreafs+aaknWahfP+ihfgl
  GRMZM2G085873_P01  82 APEKRQRVPSAYNRFIKEEIRRIKANNPDISHREAFSTAAKNWAHFPNIHFGL 134
                        ***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.8E-531134IPR006780YABBY protein
SuperFamilySSF470952.49E-879128IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.3E-580128IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MLNMVTVRCG HCTSLLSVNL RGLIQSLPVV QNHYSQEHFK VQNFSFTENY PEYAAPPSSS  60
RYRMPTMLSA KGDLDHMLHV RAPEKRQRVP SAYNRFIKEE IRRIKANNPD ISHREAFSTA  120
AKNWAHFPNI HFGLGPYESS NKLDETIGAT GHPRKIQDPY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.88271e-105ear| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G085873
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G085873_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0420101e-102BT042010.1 Zea mays full-length cDNA clone ZM_BFb0106K19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001141765.15e-93uncharacterized protein LOC100273901
SwissprotQ10FZ76e-78YAB2_ORYSJ; Protein YABBY 2
TrEMBLA0A096RAZ41e-119A0A096RAZ4_MAIZE; Uncharacterized protein
STRINGGRMZM2G085873_P011e-119(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP22101236
MonocotsOGMP139437121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.28e-48YABBY family protein