PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G084130_P01
Common NameDOF24, LOC103625855
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 379aa    MW: 39031.4 Da    PI: 8.6995
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G084130_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.18e-3864121360
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                        ++ l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+r+ + 
  GRMZM2G084130_P01  64 QTPLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRRPRP 121
                        66789*************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.8E-3166119IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-2667118IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.11567121IPR003851Zinc finger, Dof-type
PROSITE patternPS01361069105IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MIQELLVGAA MDQLKRVNDV NPASLPLLLH PVVSNPSPTS SRSSAQQRST AAATSSPQGQ  60
RAEQTPLRCP RCDSSNTKFC YYNNYNLTQP RHFCKTCRRY WTKGGALRNV PIGGGCRRPR  120
PMPTPVATKP AVSCKAVGGA PSLGLGVGLG MGMGTGAGLD GPWASSQQAA AAQAQLMALL  180
NSARGVQGGG SMHRVLGLDA IAHLPLHVLP DAGGSNASGT VPSLWPPRMD SQLGMGPLGQ  240
HDVLSSLGRL KLPPPSSAAA ASCYSDQLHA VVSSAAGRGH EYEAAAPGVT PLPCTTALAS  300
LPPAASSVSA ALASATVGLD LPPVSLPASE MQYWAGPAAM SVAWPDLPTP NGVLPRETNP  360
NLMWSCTDDA AVYPRDNTS
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G084130
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G084130_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269970.0KJ726997.1 Zea mays clone pUT3969 C2C2-DOF transcription factor (DOF24) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008644472.10.0dof zinc finger protein 4
TrEMBLA0A060D4J50.0A0A060D4J5_MAIZE; C2C2-DOF transcription factor (Fragment)
STRINGGRMZM2G084130_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.19e-33Dof family protein