PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G082490_P01
Common NameDOF45, ZEAMMB73_493136, Zm.139449
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 223aa    MW: 24019 Da    PI: 9.6526
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G082490_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.71.1e-37108163560
             zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                         l+cprC s+ntkfCy+nny+++qPr+fCk C+ryWt+GGalrnvPvG+grrkn+ 
  GRMZM2G082490_P01 108 PLPCPRCRSRNTKFCYFNNYNVNQPRHFCKDCHRYWTAGGALRNVPVGAGRRKNRP 163
                        679***************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.733109163IPR003851Zinc finger, Dof-type
PfamPF027019.7E-31109162IPR003851Zinc finger, Dof-type
PROSITE patternPS013610111147IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-19118162IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MVSHVEMGLA AGGFKLFGKV ITQCAESAPP ASLVARERDD PDERDQPVVK REAAAASDSD  60
SAVVLVDKQR RSGGPAESED SKGQHHPRPR QPQQQDTAEA RAAASAPPLP CPRCRSRNTK  120
FCYFNNYNVN QPRHFCKDCH RYWTAGGALR NVPVGAGRRK NRPLGAAPIP LAVSVPAQHL  180
QHPQHPAAAA GHGLGLPGQH PSCPTSPSPA YAGRWPVCPD RRF
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G082490
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in germinating seeds 3 to 5 days after imbibition. {ECO:0000269|PubMed:11470159}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G082490_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280390.0KJ728039.1 Zea mays clone pUT6184 C2C2-DOF transcription factor (DOF45) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008657214.11e-162dof zinc finger protein 5
SwissprotQ5JLR76e-52DOF5_ORYSJ; Dof zinc finger protein 5
TrEMBLK7V4V21e-161K7V4V2_MAIZE; C2C2-DOF transcription factor
STRINGGRMZM2G082490_P011e-162(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.11e-27Dof family protein
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]