PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G082264_P01
Common Namemwp1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family G2-like
Protein Properties Length: 477aa    MW: 48352.4 Da    PI: 7.5175
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G082264_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-32282335255
            G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                        pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  GRMZM2G082264_P01 282 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 335
                        9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15279336IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28280336IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23282335IPR006447Myb domain, plants
PfamPF002499.0E-7283334IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MEASSAASPD LSLHISLPSS AAGSGPSGRR AAVGGGTGGG GGAGGDPWRR LNGSTASTEL  60
SLSPPVEQEH ADALPWRHRP SAAAASSAAT TSAGATLMPA MPMLQPLDGG GGLGAGAGAG  120
GGASVALPIR GIPIYNGPGG FPFLPPASGA DGAPLHHHQQ QQKLGFYGSY HPSTWPSSLG  180
STSPSPSPLA PGTPPSPLLD PASAAFLSPA AHHHHRMLSA SGRLNGMLTD TLRGYGAGGV  240
GGLGGIVGGH HHHHHHLHGA QPFGLGSRFM PKLPAKRSMR APRMRWTSTL HARFVHAVEL  300
LGGHERATPK SVLELMDVKD LTLAHVKSHL QMYRTVKSTD KPAASSGAND GGSGDEDFAG  360
GGQAGSGGEN MCARPFGEHR STSEGAASSV GGGGGGDMDQ SSAGNGSTRW SNSSRDPWLS  420
SNSCNMDAHR LAALSSPIEN GEPCRSSSSQ VSNQELMSSP SLEFTLGRPD WQGTDHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-16283337357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16283337357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16283337357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16283337357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.645870.0endosperm| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G082264
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and flowers. {ECO:0000269|PubMed:18594992}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Function -- GeneRIF ? help Back to Top
  1. Recessive mutations in the maize (Zea mays) KANADI (KAN) gene milkweed pod1 (mwp1), which promotes abaxial cell identity, strongly affect development of the prophyll and silks (fused carpels).
    [PMID: 20213690]
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G082264_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9253980.0EU925398.1 Zea mays milkweed pod1 (mwp1) mRNA, complete cds.
GenBankEU9546670.0EU954667.1 Zea mays clone 1476543 myb-like DNA-binding domain, SHAQKYF class family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001353566.10.0uncharacterized protein LOC100280930 isoform 1
SwissprotQ0J2351e-158ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A1D6I3X20.0A0A1D6I3X2_MAIZE; Milkweed pod1
TrEMBLB5LZ600.0B5LZ60_MAIZE; Milkweed pod1
STRINGGRMZM2G082264_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.16e-50G2-like family protein
Publications ? help Back to Top
  1. Candela H,Johnston R,Gerhold A,Foster T,Hake S
    The milkweed pod1 gene encodes a KANADI protein that is required for abaxial/adaxial patterning in maize leaves.
    Plant Cell, 2008. 20(8): p. 2073-87
    [PMID:18757553]
  2. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]
  3. Johnston R,Candela H,Hake S,Foster T
    The maize milkweed pod1 mutant reveals a mechanism to modify organ morphology.
    Genesis, 2010. 48(7): p. 416-23
    [PMID:20213690]