PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G077124_P03
Common NamebZIP92, LOC100191211
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 285aa    MW: 31162.4 Da    PI: 10.6077
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G077124_P03genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.88.3e-17183230553
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                        +r++r++kNRe+A rsR+RK+a++ eLe+kv+ Le+eNk+L+ el+ lk
  GRMZM2G077124_P03 183 RRQKRMIKNRESAARSRARKQAYTNELENKVARLEEENKRLI-ELKVLK 230
                        79***************************************9.777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-11179241IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.151181223IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.81E-10183225No hitNo description
CDDcd147078.73E-20183229No hitNo description
Gene3DG3DSA:1.20.5.1704.6E-15183232No hitNo description
PfamPF001704.9E-14183225IPR004827Basic-leucine zipper domain
PROSITE patternPS000360186201IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGVQTMSSHS HGDDGRRGLP RQGSVYGLTL TEVETQLGEP LRTMNLDDLL RTVLPASAAA  60
AAGPPPPPAP AAKKTVDEVW RDIQSAGGGG GGRQPSMGEM TLEDFLSRAG VAVDAAPHWM  120
HQYPQQQQYA LPRPLPLPGP ALDAAYHGDR PGVFLSHSQV AGRKRAATGA VAGDGVVERT  180
VERRQKRMIK NRESAARSRA RKQAYTNELE NKVARLEEEN KRLIELKVLK PLEPLEPPPA  240
EQNKKQPPPQ PKRKQPQPPP PPPPPIQQLP PKHRHDLRRT NSATF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162185RKRAATGAVAGDGVVERTVERRQK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.193250.0ear| endosperm| ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G077124
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G077124_P03
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0332470.0BT033247.1 Zea mays full-length cDNA clone ZM_BFb0124H20 mRNA, complete cds.
GenBankBT0554750.0BT055475.1 Zea mays full-length cDNA clone ZM_BFb0325H08 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001130117.10.0uncharacterized protein LOC100191211
SwissprotQ9C5Q21e-55AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3
TrEMBLB4F8090.0B4F809_MAIZE; ABSCISIC ACID-INSENSITIVE 5-like protein 2
STRINGGRMZM2G077124_P030.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44413367
Representative plantOGRP5401580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G41070.37e-42bZIP family protein
Publications ? help Back to Top
  1. Haas BJ, et al.
    Full-length messenger RNA sequences greatly improve genome annotation.
    Genome Biol., 2002. 3(6): p. RESEARCH0029
    [PMID:12093376]
  2. Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC
    Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription.
    Plant Cell Rep., 2016. 35(1): p. 155-66
    [PMID:26441053]
  3. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]