PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G074543_P03
Common NameYAB9, Zm.11824
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family YABBY
Protein Properties Length: 314aa    MW: 32850.2 Da    PI: 8.7499
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G074543_P03genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY79.21.2e-244696555
              YABBY  5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasq 55
                        ++eq+Cyv+C fC+t+l+vsvP++slfk+vtvrCGhC+sll+v+++    
  GRMZM2G074543_P03 46 PAAEQLCYVHCYFCDTVLVVSVPTSSLFKTVTVRCGHCSSLLTVDMRGLLF 96
                       6789****************************************9987665 PP

2YABBY127.91.4e-39201266106170
              YABBY 106 deevprvpp.virPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                        +e +pr+ p v+rPPekrqrvPsaynrfik+eiqrika+nP+ishreafsaaaknWahfP+ihfgl
  GRMZM2G074543_P03 201 KEPSPRANPaVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPNISHREAFSAAAKNWAHFPHIHFGL 266
                        56678887779*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046905.6E-6048266IPR006780YABBY protein
SuperFamilySSF470951.3E-7207259IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.106.9E-4215258IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MSSSSSSSSS SAATVFPRSP QLPPPVLVEN GLTPLHQLTP VAAAAPAAEQ LCYVHCYFCD  60
TVLVVSVPTS SLFKTVTVRC GHCSSLLTVD MRGLLFPGTP TDTVAGAAPP PAADTSTTTT  120
TITTAPPPAN SVNNGQFHLP HSLNHPHHQS LLVDEISSAA NPSLQLQLEQ HGGLGGLILG  180
GSRNTAAPPP PQPPAAGKGA KEPSPRANPA VNRPPEKRQR VPSAYNRFIK DEIQRIKAGN  240
PNISHREAFS AAAKNWAHFP HIHFGLMPDH QGLKTTSLLP QDHQRKDGLL KEGLYAAAAA  300
AAAHAAANMG IAPY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.118240.0meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G074543
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G074543_P03
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7279910.0KJ727991.1 Zea mays clone pUT6111 C2C2-YABBY transcription factor (YAB9) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105231.10.0yabby 9
SwissprotQ8L5562e-96YAB3_ORYSJ; Protein YABBY 3
TrEMBLA0A060D1X10.0A0A060D1X1_MAIZE; C2C2-YABBY transcription factor (Fragment)
STRINGGRMZM2G074543_P041e-164(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.17e-43YABBY family protein