PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G074124_P05
Common NameIDP681, YAB6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family YABBY
Protein Properties Length: 192aa    MW: 21659.6 Da    PI: 7.8159
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G074124_P05genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY235.41.3e-7281663170
              YABBY   3 vfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesast 94 
                        +   +e+vCyv+CnfCntilavsvPs s++++vtvrCGhCtsllsvnl+   q l++++h       +++e+  v+++ +++n+ ++  + +
  GRMZM2G074124_P05   8 IAPVPEHVCYVHCNFCNTILAVSVPSHSMLNIVTVRCGHCTSLLSVNLRGLIQSLPVQNH----HYSQQQENFTVQNMGFTENYPEYAPSYR 95 
                        56789******************************************************9....5566788999999999999988877666 PP

              YABBY  95 svsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                          ++    + + +++ +    +r PekrqrvPsaynrfikeei+rika+nPdishreafs+aaknWahfP+ihfgl
  GRMZM2G074124_P05  96 MPTT-LSAKGDLDHMLH----VRAPEKRQRVPSAYNRFIKEEIRRIKACNPDISHREAFSTAAKNWAHFPNIHFGL 166
                        5554.324555566665....899**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.8E-7012166IPR006780YABBY protein
SuperFamilySSF470957.33E-8111160IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.107.7E-5112160IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MSSAPLQIAP VPEHVCYVHC NFCNTILAVS VPSHSMLNIV TVRCGHCTSL LSVNLRGLIQ  60
SLPVQNHHYS QQQENFTVQN MGFTENYPEY APSYRMPTTL SAKGDLDHML HVRAPEKRQR  120
VPSAYNRFIK EEIRRIKACN PDISHREAFS TAAKNWAHFP NIHFGLGPCE SSNNLDEATG  180
AMCHPQKVQD LY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.88270.0ear| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G074124
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G074124_P05
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0420100.0BT042010.1 Zea mays full-length cDNA clone ZM_BFb0106K19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001141765.11e-145uncharacterized protein LOC100273901
SwissprotQ10FZ74e-97YAB2_ORYSJ; Protein YABBY 2
TrEMBLB4FY221e-145B4FY22_MAIZE; C2C2-YABBY transcription factor
STRINGGRMZM2G074124_P041e-144(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.24e-58YABBY family protein
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]