PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G073892_P01
Common Namepco118647
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 171aa    MW: 18616.9 Da    PI: 9.5873
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G073892_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.34.4e-1596154563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        ++ +r+++NRe+A rsR+RK+a+++eLe++v  L +eN +Lk + ++lk  +a+l +++
  GRMZM2G073892_P01  96 RKNIRMMRNRESALRSRARKRAYVQELEKEVRRLVNENLKLKRQCKQLKLDMAALVQQS 154
                        6789*********************************************9999998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.1E-1392156IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-1593153No hitNo description
PROSITE profilePS5021711.4594150IPR004827Basic-leucine zipper domain
CDDcd147071.08E-1396145No hitNo description
SuperFamilySSF579591.56E-1196152No hitNo description
PfamPF001703.6E-1296153IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MPRSPQLSLS GCSSLFSLSS TSTSRDSAAL KAPVPAPPAG AVPPRRTPLL SLSVGEEEED  60
EGEDEEEYLL GAGALDLQLT GPGGGSNSSG GYDDERKNIR MMRNRESALR SRARKRAYVQ  120
ELEKEVRRLV NENLKLKRQC KQLKLDMAAL VQQSSSKSSS HIRRTSSSTQ L
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.849520.0glume| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G073892
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G073892_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9563240.0EU956324.1 Zea mays clone 1560828 bZIP transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147710.11e-119uncharacterized protein LOC100281320
TrEMBLB6SUA91e-117B6SUA9_MAIZE; BZIP transcription factor
STRINGGRMZM2G073892_P011e-118(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Representative plantOGRP9528513
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.12e-08ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]