PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G073823_P01
Common NameGRAS68, ZEAMMB73_787421, Zm.26078
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 642aa    MW: 71250.6 Da    PI: 7.1461
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G073823_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS313.16e-962466352373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                          lLl+cA+av+++d ++a+ lLa+++ ++sp+gd+ qRla++f+ +L+arla+++s+ly++l  ++ts   +++ l a++l+  ++ + ++
  GRMZM2G073823_P01 246 HALLLRCAQAVATDDRAAAKDLLAQVRRHSSPTGDAAQRLAHCFADGLEARLAGTGSRLYQSLMLRRTS---VADFLRAYRLYMTTCCCKRV 334
                        579**************************************************************9999...******************** PP

               GRAS  94 shltaNqaIleavege...ervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                        ++  aN++I +a++ +   +r+Hi+D+++++G+QWp Ll+ La+R++gpp  +RiTg++ p++g   ++++e tg+rL++ A++lgvpfef+
  GRMZM2G073823_P01 335 AFAFANKTIHDAFALAgrrRRLHIVDYGLGYGFQWPGLLRGLAAREGGPPeLVRITGIDLPQPGfrPAQQIEDTGRRLSDCARQLGVPFEFR 426
                        ************987766799*************************9999689**********9**************************** PP

               GRAS 180 vlvakrledleleeLrvkp.gEalaVnlvlqlhrll................desvsleserdevLklvkslsPkvvvvveqeadhnsesFl 254
                          +a + e++++e+L ++p  E+l+V +  +    l                 +    + +rd+vL  +++++P+v+++      ++++ F 
  GRMZM2G073823_P01 427 G-IAAKREAVSPEDLGIDPaAEVLVVISLCHFRL-LtdeieveisssaaaagPSGRRRPTARDQVLCNIRRMRPDVFIHGVVSGGYGTTYFP 516
                        *.69999************888888877775554.4599******999988644444555889***************************** PP

               GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                        +rf ea+ +ysa fd l+a++pr+s er  +Er ++gr+++nv+acega+r+er et+++W++r ++aG+k+++l+ +++k ++  ++  + 
  GRMZM2G073823_P01 517 TRFREAMFHYSAQFDLLDATVPRDSPERLLLERDIFGRAAMNVIACEGADRVERPETYRQWQARNRRAGLKQLQLQADVVKVVRDKVKDKYH 608
                        *****************************************************************************************999 PP

               GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaW 373
                        + + ++e++g+l+ +Wk+r L+ +S W
  GRMZM2G073823_P01 609 RDFGIDEDQGWLLHTWKGRVLYGLSTW 635
                        99************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.038219616IPR005202Transcription factor GRAS
PfamPF035142.1E-93246635IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020127anatomyprimary root
PO:0007106developmental stageLP.03 three leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MAAAPLPSQN LELELDLFHL HPDPPSPSVF LDLPPTPPPT YLDDDDMVLP YISRLLMEEE  60
DAHTHSFFYQ YPDHPALLNA QQPFADILAD IAAAASPSSS SVDTTDGAHG DAPLQAQADH  120
SPNGRDADAD MATSAFLKGM QEATRFLPLP TSDATLLHNS RGRKNKHAVA RDDEPESGRA  180
TKLMLPAHTT DDADARQMFH ELMTHERDDI CMKGVQLHGT ASTQKKATRR RRRRSPAAAA  240
DAVDLHALLL RCAQAVATDD RAAAKDLLAQ VRRHSSPTGD AAQRLAHCFA DGLEARLAGT  300
GSRLYQSLML RRTSVADFLR AYRLYMTTCC CKRVAFAFAN KTIHDAFALA GRRRRLHIVD  360
YGLGYGFQWP GLLRGLAARE GGPPELVRIT GIDLPQPGFR PAQQIEDTGR RLSDCARQLG  420
VPFEFRGIAA KREAVSPEDL GIDPAAEVLV VISLCHFRLL TDEIEVEISS SAAAAGPSGR  480
RRPTARDQVL CNIRRMRPDV FIHGVVSGGY GTTYFPTRFR EAMFHYSAQF DLLDATVPRD  540
SPERLLLERD IFGRAAMNVI ACEGADRVER PETYRQWQAR NRRAGLKQLQ LQADVVKVVR  600
DKVKDKYHRD FGIDEDQGWL LHTWKGRVLY GLSTWVAQHA DP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-402496358374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1228233RRRRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.994470.0leaf
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G073823
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G073823_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270200.0KJ727020.1 Zea mays clone pUT4001 GRAS transcription factor (GRAS68) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677822.10.0PREDICTED: scarecrow-like protein 34
TrEMBLK7U8D10.0K7U8D1_MAIZE; GRAS transcription factor
STRINGGRMZM2G073823_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1707333
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-108GRAS family protein