PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G073779_P01
Common NameLOC100501842, ZEAMMB73_007326
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 686aa    MW: 76470.4 Da    PI: 4.8064
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G073779_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3273.6e-1002976702373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         +lL++cA+av++++ + a++lL ++++++sp+gd++qRla++f+e+L+arla+s+s+ly++l +++ +     e l a+ l+  ++ +   
  GRMZM2G073779_P01 297 STLLVHCAQAVATDNRRSATELLRQIKQQSSPKGDATQRLAHCFAEGLEARLAGSGSQLYRSLMAERIP---AMEYLRAYWLYLAACCFKMT 385
                        579************************************************************999998...899***************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                        ++   N++Il+a++g ++vHi+D++i +G+QWp+Ll   a+ +  +gpp++RiTg++ p++g   + ++ etg+rL+++A+++gvpf+f+  
  GRMZM2G073779_P01 386 AFSFSNKTILKAIAGRRKVHIVDYGIDYGVQWPSLLGRVATMDmeGGPPEVRITGIDLPQPGfrPAARIDETGRRLSDYARQIGVPFKFRG- 476
                        ****************************************8887799**************999***************************. PP

               GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                        ++ r++++  ++L+++p+E+l+Vn++++  +l+de ++++s  +rd vL ++++ +P+ +++   +++++++ F++rf eal +ysa+fd+l
  GRMZM2G073779_P01 477 ITARWDAVGADDLSIDPDEVLIVNSIVRFGNLMDEGADIDSpsARDVVLGAIREARPDAFILHVMNVSYGAPFFVTRFREALFFYSAMFDML 568
                        699********************************999998889************************************************ PP

               GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                        +a++pr+s++r +vEr ++++ + nvvaceg +r+er et+++W++r ++aG++++pl+ +++   +  +r+ + + + ++ ++++l+ gWk
  GRMZM2G073779_P01 569 DATAPRDSRQRFMVERGFFRQCALNVVACEGVDRVERPETYRQWQARNRRAGLRQLPLDPDTVRALREKVREQYHRDFVIDTDRDWLLEGWK 660
                        **************************************************************************999*************** PP

               GRAS 364 drpLvsvSaW 373
                        +r L+++S W
  GRMZM2G073779_P01 661 GRILYAMSTW 670
                        ********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.884270651IPR005202Transcription factor GRAS
PfamPF035141.2E-97297670IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0025541anatomybundle sheath cell
PO:0025589anatomyleaf lamina tip
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 686 aa     Download sequence    Send to blast
MAAAPEAEGL FGDPEPFSPS IFLDLPPTPR PDGNDEVPAS SDDLVLPFIT RILMEEDIND  60
QFFYQFPDHP VLLRAQEPYA QILSEPATAR AASGSPATVS PSSDEDPVQP LLSPPYPDTG  120
LRDINDDGVG ASPGFEQSDP GKLRTAALGL PTGDGDRAAL APVFFNSGDA DAEMLNKAFL  180
KGMEEAKKFL PTTSSSLLIY PPGAEEELGI NGRGRKDRDR LGWDDLEAET FRKSKLMVPE  240
PEETDEMVDQ MIFNGLEMCL REMKALRISM GSGEAKKNSR KGKQGRRSSA DEAVELSTLL  300
VHCAQAVATD NRRSATELLR QIKQQSSPKG DATQRLAHCF AEGLEARLAG SGSQLYRSLM  360
AERIPAMEYL RAYWLYLAAC CFKMTAFSFS NKTILKAIAG RRKVHIVDYG IDYGVQWPSL  420
LGRVATMDME GGPPEVRITG IDLPQPGFRP AARIDETGRR LSDYARQIGV PFKFRGITAR  480
WDAVGADDLS IDPDEVLIVN SIVRFGNLMD EGADIDSPSA RDVVLGAIRE ARPDAFILHV  540
MNVSYGAPFF VTRFREALFF YSAMFDMLDA TAPRDSRQRF MVERGFFRQC ALNVVACEGV  600
DRVERPETYR QWQARNRRAG LRQLPLDPDT VRALREKVRE QYHRDFVIDT DRDWLLEGWK  660
GRILYAMSTW VADDDAVSEH HHTYTY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-423006708374GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G073779
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G073779_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0863590.0BT086359.1 Zea mays full-length cDNA clone ZM_BFc0156L24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001183419.10.0uncharacterized protein LOC100501842
TrEMBLC4J6B20.0C4J6B2_MAIZE; Uncharacterized protein
STRINGGRMZM2G073779_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-144GRAS family protein