PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G071112_P01
Common NameLOC100285819
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family ZF-HD
Protein Properties Length: 89aa    MW: 9802.04 Da    PI: 7.9935
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G071112_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.16.7e-311876160
        ZF-HD_dimer  1 kekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                       +++vrY +C++NhAas+GghavDGC+Ef+++ geegt+ alkCaACgCHR+FHRr +++e
  GRMZM2G071112_P01 18 CCSVRYGDCRRNHAASTGGHAVDGCREFIAE-GEEGTSGALKCAACGCHRSFHRRVQVYE 76
                       5789**************************8.999********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-24179IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.5E-302173IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.6E-232271IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.2742372IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MKRLLILQRC EPIVRFSCCS VRYGDCRRNH AASTGGHAVD GCREFIAEGE EGTSGALKCA  60
ACGCHRSFHR RVQVYEVAWG YGSDTSSTE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1278981e-152shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G071112
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G071112_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9741561e-149EU974156.1 Zea mays clone 441364 mini zinc finger 3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023156305.15e-60mini zinc finger 3 isoform X1
SwissprotQ6ER221e-31MIF3_ORYSJ; Mini zinc finger protein 2
TrEMBLA0A1D6I4966e-59A0A1D6I496_MAIZE; Mini zinc finger 3
TrEMBLA0A3L6E1415e-59A0A3L6E141_MAIZE; Mini zinc finger protein 2
STRINGGRMZM2G071112_P013e-59(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.17e-25mini zinc finger 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]