PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G069274_P02
Common NameZm.28488
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family WOX
Protein Properties Length: 273aa    MW: 30387.8 Da    PI: 6.5109
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G069274_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.32.1e-2195155257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        r+R+++t+ ql++Le+ F + n +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  GRMZM2G069274_P02  95 RQRWQPTPMQLQILENIFDQgNGTPSKQRIKEITAELshhgQISETNVYNWFQNRRARSKR 155
                        89*****************99**************************************97 PP

2Wus_type_Homeobox100.81e-3294157265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RW Ptp Q++iLe+++++G  tP+k++i++itaeL+++G+i+++NV++WFQNr+aR+++kq
  GRMZM2G069274_P02  94 ARQRWQPTPMQLQILENIFDQGNGTPSKQRIKEITAELSHHGQISETNVYNWFQNRRARSKRKQ 157
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-1790160IPR009057Homeodomain-like
PROSITE profilePS5007114.94991156IPR001356Homeobox domain
SMARTSM003891.3E-1493160IPR001356Homeobox domain
SuperFamilySSF466891.58E-1894158IPR009057Homeodomain-like
PfamPF000463.5E-1995155IPR001356Homeobox domain
CDDcd000864.10E-1595157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEWVDRTKAS AAAAAAAADE RAGGAEGLAG YVKVMTDEQM EVLRKQISIY ATICEQLVEM  60
HRALTEHQDT IAGIRFSNLY CDPQIIPGGH KITARQRWQP TPMQLQILEN IFDQGNGTPS  120
KQRIKEITAE LSHHGQISET NVYNWFQNRR ARSKRKQAAS LPNNAESEAE VDEESLTDKK  180
PKSDRSLQDN KAMGAHNADR ISGMHHLDTD HDQIGGMMYG CNDNGLRSSG SSGQMSFYGN  240
IMPNPRIDHF PGKVESSRSF SHLQHGEGFD MFG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148156RRARSKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.284880.0ear| meristem| root| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G069274
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G069274_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0639190.0BT063919.1 Zea mays full-length cDNA clone ZM_BFc0120C21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288365.10.0WUSCHEL-related homeobox 8-like
RefseqXP_008652675.10.0PREDICTED: WUSCHEL-related homeobox 8-like
SwissprotQ5QMM31e-131WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLA0A096QE430.0A0A096QE43_MAIZE; Uncharacterized protein
STRINGGRMZM2G038252_P020.0(Zea mays)
STRINGGRMZM2G069274_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.16e-58WUSCHEL related homeobox 13