PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G069028_P02
Common Namens1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family WOX
Protein Properties Length: 246aa    MW: 25981.9 Da    PI: 8.2208
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G069028_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox46.65.7e-152501457
                       HHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox 14 eLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                       +Lee++++  r+p+a+e+++++++l    +++ ++V++WFqN++a+e++
  GRMZM2G069028_P02  2 ILEEMYRSgVRTPNAAEIQQITAHLayygRIEGKNVFYWFQNHKARERQ 50
                       8******99**************************************97 PP

2Wus_type_Homeobox93.51.9e-301511464
  Wus_type_Homeobox 14 kiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       +iLee+y+sG+rtPn++eiq+ita+L+ yG+ie+kNVfyWFQN+kaRerq+
  GRMZM2G069028_P02  1 MILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKARERQR 51
                       69************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.88151IPR001356Homeobox domain
PfamPF000461.2E-12250IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-4250IPR009057Homeodomain-like
SuperFamilySSF466893.02E-7251IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0009089anatomyendosperm
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MILEEMYRSG VRTPNAAEIQ QITAHLAYYG RIEGKNVFYW FQNHKARERQ RLRRRLCARH  60
QQQYAQQQAT AAAPASSPNS SATVPSLAAG GSSAGVHPAV MQLHHHQHPY ATNFMPHQLG  120
YMGQQVATVP PVLNPAAAGM VDLAAARAGG GNKATAAGSG AYGGGAGLYN SCSSNQLEEW  180
EATDAMEHCD ASCGAASGSS DEGGALQLPP CCRRPLKTLD LFPTKSTGLK DECSSSKSSS  240
CSTSTN
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G069028
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G069028_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0661200.0BT066120.1 Zea mays full-length cDNA clone ZM_BFb0350F05 mRNA, complete cds.
GenBankAJ5365780.0AJ536578.1 Zea mays mRNA for homeodomain transcription factor (prs gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105160.10.0WUSCHEL-related homeobox 3A
SwissprotQ70UV10.0WOX3A_MAIZE; WUSCHEL-related homeobox 3A
TrEMBLA0A096QZV20.0A0A096QZV2_MAIZE; Uncharacterized protein
STRINGGRMZM2G069028_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.13e-25WOX family protein