PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G067921_P01
Common NameDLF1, Zm.105296
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 204aa    MW: 21508 Da    PI: 9.5194
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G067921_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_158.51.4e-18133186457
                        XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                        ++r +r++kNRe+A rsR+RK+a++ eLe+kv+ L++eN++L+ + +el++ v+
  GRMZM2G067921_P01 133 DRRKKRMIKNRESAARSRARKQAYVRELETKVQLLQQENESLRVKYDELRESVE 186
                        799***********************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-16130194IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.289132186IPR004827Basic-leucine zipper domain
PfamPF001707.8E-17133186IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-16133187No hitNo description
SuperFamilySSF579591.56E-13134187No hitNo description
CDDcd147074.99E-21134181No hitNo description
PROSITE patternPS000360137152IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MEDDEDIWAN TASSPSASPP QPVAAGSVST CSAFISTQLS LNSRLHLLSS AAAGGGSSPV  60
RGGAYGADGV RHHHMALGGG FRNAAASQGS FFPYNLAGAG ADVAPFDGGR GVLEDDMSVG  120
AAASGTWAGG GTDRRKKRMI KNRESAARSR ARKQAYVREL ETKVQLLQQE NESLRVKYDE  180
LRESVEVAVP MVRKTLQRMP SAPF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1052960.0meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G067921
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G067921_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0937890.0EF093789.1 Zea mays delayed flowering1 (DLF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105962.11e-146uncharacterized protein LOC100037791
TrEMBLA0A3L6E3Q11e-147A0A3L6E3Q1_MAIZE; BZIP transcription factor 27
TrEMBLA1E2401e-147A1E240_MAIZE; Delayed flowering1
STRINGGRMZM2G067921_P011e-147(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Representative plantOGRP1475044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17770.22e-19basic region/leucine zipper motif 27
Publications ? help Back to Top
  1. Muszynski MG, et al.
    delayed flowering1 Encodes a basic leucine zipper protein that mediates floral inductive signals at the shoot apex in maize.
    Plant Physiol., 2006. 142(4): p. 1523-36
    [PMID:17071646]