PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G065478_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family B3
Protein Properties Length: 193aa    MW: 20628 Da    PI: 7.4143
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G065478_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B350.44.1e-168791487
                       T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                 B3 14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
                        + ++p kf+++ +g+   + tl+l+++sg +W v +  +   ++ +l++GW +F++a++L+e D vvF++ g 
  GRMZM2G065478_P01  8 MNKSIPEKFVSDPNGQ--LTETLSLKSPSGATWLVDVARNADADELLLGSGWGDFARAHELQEDDLVVFTRGGG 79
                       4579******888888..6669***************87888888*************************6543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.52196IPR003340B3 DNA binding domain
PfamPF023627.8E-13779IPR003340B3 DNA binding domain
SuperFamilySSF1019364.12E-1510101IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.1E-151198IPR015300DNA-binding pseudobarrel domain
CDDcd100173.60E-151194No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006310anatomytassel floret
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009066anatomyanther
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0001007developmental stagepollen development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MQEHWSRMNK SIPEKFVSDP NGQLTETLSL KSPSGATWLV DVARNADADE LLLGSGWGDF  60
ARAHELQEDD LVVFTRGGGG GSGSGCSFDV LVLDSSGCEK APCFFAANKV HGRFSGGGRR  120
QAARRRVFRG PEPEGLGAQL RLAAAAASTH GASTSKQKCG ETDKPSRAER FDIMKRDGCG  180
FNEIEAQARV SPL
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G065478
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G065478_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9448360.0EU944836.1 Zea mays clone 233444 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008666379.11e-124PREDICTED: uncharacterized protein LOC103645024
TrEMBLA0A096QXL01e-140A0A096QXL0_MAIZE; Uncharacterized protein
STRINGGRMZM2G065478_P011e-139(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6299819
MonocotsOGMP56234179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.11e-10B3 family protein