PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G064655_P01
Common NameDOF34, LOC100276996
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 351aa    MW: 35324.3 Da    PI: 7.7504
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G064655_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.7e-393897362
             zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        +al+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ss
  GRMZM2G064655_P01 38 AEALRCPRCDSANTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRSS 97
                       57899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-283994IPR003851Zinc finger, Dof-type
PfamPF027011.6E-334095IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3854195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006340anatomyadult vascular leaf
PO:0009025anatomyvascular leaf
PO:0020040anatomyleaf base
PO:0020126anatomytassel inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MAGAGCATAV QRPAAAGAPA AVARTAVGAG GAVADPRAEA LRCPRCDSAN TKFCYYNNYS  60
LSQPRHFCKA CKRYWTRGGT LRNVPVGGGC RKNKRSSRSG GGGRNGSSSS FSSSSADSTA  120
LPLPPPPTTM GSLPSSLGLP GGASLLLGSA LPGGAGDHHH LGLFQAAMQS VVSSDATAYD  180
EMQQQQQTQL DHLLGLGYGG GAGAQIQLKP WMQEAAGAGG APGIMDSFYA PLLSSSLVPG  240
LEELHVKAEA AGAGDHQQKP SSRDQQSASW DWELPTPSSS NVDANVVTAS DALMAAAAAA  300
SMNPAVSVSS TPSTAPTAPS SFLYWGNSGI GGAAAAWPDL ANCGSSIATL F
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.211080.0pollen| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G064655
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G064655_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7276860.0KJ727686.1 Zea mays clone pUT5625 C2C2-DOF transcription factor (DOF34) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001144144.20.0uncharacterized protein LOC100276996
TrEMBLA0A060D1210.0A0A060D121_MAIZE; C2C2-DOF transcription factor (Fragment)
STRINGGRMZM2G064655_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88953041
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-33TARGET OF MONOPTEROS 6