PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G063203_P01
Common NameLOC100273264, ZEAMMB73_888358, Zm.84424
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Trihelix
Protein Properties Length: 668aa    MW: 71709.6 Da    PI: 5.9776
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G063203_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix94.21.3e-2995179187
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                        rW+++e+laLi++r+em+ ++r++ lk+plWe v++k++  g++rs+k+Ckek+en+ k+y+++k+ + +r++++s  +++f+qlea
  GRMZM2G063203_P01  95 RWPREETLALIRIRTEMDADFRSSPLKAPLWENVARKLAGLGYHRSAKKCKEKFENVDKYYRRTKDARAGRQDGKS--YRFFSQLEA 179
                        8*********************************************************************866665..*******85 PP

2trihelix106.81.5e-33408493187
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                        rW+k+ev aLi++r+e++e++ ++ +k+plWe+++++mr  g++rs+k+Ckekwen+nk+ykk+ke++k+r +e+s+tcpyf+ql+a
  GRMZM2G063203_P01 408 RWPKEEVEALIQMRNEKGEKYHDAGAKGPLWEDIAAAMRGIGYSRSAKRCKEKWENINKYYKKVKESNKRR-PEDSKTCPYFHQLDA 493
                        8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.03988152IPR017877Myb-like domain
SMARTSM007173.2E-492154IPR001005SANT/Myb domain
CDDcd122031.01E-2694159No hitNo description
PfamPF138373.4E-2094180No hitNo description
SMARTSM007178.0E-8405467IPR001005SANT/Myb domain
CDDcd122036.41E-24407472No hitNo description
Gene3DG3DSA:1.10.10.607.9E-6407464IPR009057Homeodomain-like
SuperFamilySSF466893.16E-6407480IPR009057Homeodomain-like
PROSITE profilePS500908.409407465IPR017877Myb-like domain
PfamPF138372.1E-22408494No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 668 aa     Download sequence    Send to blast
MLHHHGGAGS PYMAPETAGT GTGTAPFSPT PTGLAVSVTA AIPALPTMQL QPAGSSANFE  60
ELAAGGSGAG VAVRLQDEDM QADLGASGAG ASGNRWPREE TLALIRIRTE MDADFRSSPL  120
KAPLWENVAR KLAGLGYHRS AKKCKEKFEN VDKYYRRTKD ARAGRQDGKS YRFFSQLEAL  180
HASAPPLPPP PSGMTTVQAG PHQPMEMAWT AGPTVLGPAA VAGLPDLSFS SMSESDSEYD  240
SDDDDDDSGA GEEGLSGGEC DREMMATFER MMKQFTEKQD AMQRVFLETL ERCEAERTAR  300
EEAWRRQEVA RMNREREQLA RERAAAASRD AALIAFLQRV GGGQGEPARL PPHGAGVVPP  360
PPMPDCAPPS PRRHAAAASL QQLVPVPPKA VEALARAGGE GGGSTPSRWP KEEVEALIQM  420
RNEKGEKYHD AGAKGPLWED IAAAMRGIGY SRSAKRCKEK WENINKYYKK VKESNKRRPE  480
DSKTCPYFHQ LDAMYRNKHR SGTGGRTAPR TNMASAVAVA ATVQDNPSKR ELEGKSSNDA  540
DNRKNDEQGN VLTSPASGDT APGGAAKNKT AEGNVDDTDV QHQHQQRFSA DETDSDDDMD  600
MARNYTVYTE EGNNEDKMKY KMGVQERDVI GSSGNVLAPP PSPAAVAATA AAPTSSAAPT  660
SSTFLAVQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.320070.0ovary| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G063203
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G063203_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280320.0KJ728032.1 Zea mays clone pUT6172 trihelix transcription factor (THX16) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001310892.10.0trihelix transcription factor GTL1
RefseqXP_008678887.10.0trihelix transcription factor GTL1 isoform X1
TrEMBLA0A3L6EZL50.0A0A3L6EZL5_MAIZE; Trihelix transcription factor GT-2
TrEMBLK7TYX10.0K7TYX1_MAIZE; Putative homeodomain-like transcription factor superfamily protein isoform 1
STRINGGRMZM2G063203_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-41Trihelix family protein