PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G062711_P01
Common NameTCP28, ZEAMMB73_759210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family TCP
Protein Properties Length: 187aa    MW: 21582.1 Da    PI: 12.4541
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G062711_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP76.38.5e-24137186352
                TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLl 52 
                         ++d hski  ++g RdRR+Rls+ + ++fF+Lqd+LGfdk+skt++WLl
  GRMZM2G062711_P01 137 FRTDWHSKIRKAQGVRDRRMRLSVGVTREFFALQDRLGFDKASKTVNWLL 186
                        689**********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136925.399138187IPR017887Transcription factor TCP subgroup
PfamPF036342.2E-22138186IPR005333Transcription factor, TCP
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0020040anatomyleaf base
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007022developmental stageseed imbibition stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MDHSIQPSRQ RLCARKNRVS VAAVVPPLTP LSPPSPTPRS RQPPRPDPDP PSAARPWLPD  60
LTASVDAAPP PSPLKSDQRL VEVFTPFLEK LIRLRRAPFQ HPGLRRPPYR RWRVRGSCRA  120
TGRRRWWMTP ASRPRPFRTD WHSKIRKAQG VRDRRMRLSV GVTREFFALQ DRLGFDKASK  180
TVNWLLA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.398044e-66tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G062711
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G062711_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280370.0KJ728037.1 Zea mays clone pUT6182 TCP transcription factor (TCP28) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK7UD831e-127K7UD83_MAIZE; TCP transcription factor (Fragment)
STRINGGRMZM2G062711_P011e-128(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40523172
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18550.22e-19TCP family protein