PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G062391_P01
Common NameZm.26244
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 346aa    MW: 37378.7 Da    PI: 6.931
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G062391_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.51.6e-09150197552
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                        kr++r   NR +A rs +RK  ++  Le+kv++L++e ++L  +l   
  GRMZM2G062391_P01 150 KRAKRILANRQSAARSKERKARYMTDLERKVQTLQTEATTLSAQLTLF 197
                        9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-14146210IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.427148211IPR004827Basic-leucine zipper domain
PfamPF001703.1E-8150197IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.64E-11150201No hitNo description
Gene3DG3DSA:1.20.5.1706.2E-10150204No hitNo description
CDDcd147033.79E-21151200No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MQQPGPADLP GWAFPPRAGP APAAARGAHH RRARSEVAFR LPDDLGLGGG AGPDGDAFDE  60
IGSEDDLFST FMDIEKISTS GPSDRAAENS SPPRPKHRHS SSVDGSGFFF SPGAGGGAGK  120
DAAASLAEVL EAKKSMTPEQ LAELAAIDPK RAKRILANRQ SAARSKERKA RYMTDLERKV  180
QTLQTEATTL SAQLTLFQRD TTGLSTENAE LKIRLQAMEQ QAQLRDALND ALKQELERLK  240
HATGEMTNSS EAYNMRFQHV PYNSSFFPLS QQNASPHLGS TQLPLPFHPP HPNVPNHQMV  300
SHRNTLPDIM QQESLGRLQG LDIGKGPLVV KLESSSISAS ESSSTF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.262440.0meristem| pollen| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G062391
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in roots, low level in leaf sheath, but not in leaf blade. Predominantly expressed in vascular tissues. {ECO:0000269|PubMed:14704272}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:14704272}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G062391_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0614590.0BT061459.1 Zea mays full-length cDNA clone ZM_BFb0148I18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001152693.10.0uncharacterized protein LOC100286334
SwissprotQ6S4P41e-160RF2B_ORYSJ; Transcription factor RF2b
TrEMBLC0HGK30.0C0HGK3_MAIZE; Basic leucine-zipper 52
TrEMBLK4JC790.0K4JC79_MAIZE; BZIP-type transcription factor (Fragment)
STRINGGRMZM2G062391_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.18e-69bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]