PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G061292_P01
Common NameLOC103626052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 335aa    MW: 33815.9 Da    PI: 9.1287
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G061292_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.31.1e-35102157560
             zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                          +cprC s++tkfCyynny++sqPr+fC+aCrryWt GG+lrnvP+Gg++rk+ +
  GRMZM2G061292_P01 102 GEQCPRCASHDTKFCYYNNYNTSQPRHFCRACRRYWTLGGSLRNVPIGGSTRKRPR 157
                        579*************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.559103157IPR003851Zinc finger, Dof-type
PfamPF027015.4E-31103155IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-22104150IPR003851Zinc finger, Dof-type
PROSITE patternPS013610105141IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MASQAQAARL QPPTMAPFAP LPHNACKHDA VRHHLNTMAA TWCGSTNNNV TATGAMAAAT  60
SGSTSNSNAA PGGGATDMAA YLQQLQDAAA AKSSGGGGAT RGEQCPRCAS HDTKFCYYNN  120
YNTSQPRHFC RACRRYWTLG GSLRNVPIGG STRKRPRLAH PHPQQHARRA PAAHVFGLGL  180
GIGGVAPPPP PPMMLPSSST SSPPSQGQGG GGLLGSLFAL GAAGPLLEGR GAGSSFDFDF  240
DLGLGLPTGP LHLGAGEAAA AQMQGLGLRG GGPAAGSSAF LWPAGAGMLV DNDSVDTWKL  300
PGTSAGSMWP DFSSLAAAAP QTGGLMHGGA HAHLM
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G061292
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G061292_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824061e-110KC582406.1 Sorghum bicolor dof9 protein (dof9) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008644658.10.0dof zinc finger protein DOF3.4
TrEMBLA0A1D6GLQ10.0A0A1D6GLQ1_MAIZE; Dof zinc finger protein DOF1.6
STRINGGRMZM2G061292_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-26DOF zinc finger protein 1