PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G057413_P01
Common NameZm.9312
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bHLH
Protein Properties Length: 248aa    MW: 26791 Da    PI: 6.3904
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G057413_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH46.37.5e-1575127155
                        CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                        r+ +hn+ Er RR+++N+ ++ Lr+llP a   + kKls  +++ ++ +YI +Lq
  GRMZM2G057413_P01  75 RKLSHNAYERDRRKQLNDLYSSLRSLLPDA--DHTKKLSIPTTVSRVLKYIPELQ 127
                        6889*************************7..35666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.96E-1672142IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000837.30E-1374130No hitNo description
PROSITE profilePS5088814.1774126IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000105.0E-1275127IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.1E-1375142IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003535.9E-1080132IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MISMDHQMFD DPFGSSGISS LEADIFSAAA GSQLPSPPWP DFDDDYDIPD LSALPANAAT  60
SSGGGYGSGG SGGHRKLSHN AYERDRRKQL NDLYSSLRSL LPDADHTKKL SIPTTVSRVL  120
KYIPELQKQV DNLERRKREL TNANCKPGVL NTSEIVTTPI VSATCLNDTE IMVQVSLHSN  180
VAATALPLSK CIKVLEDAGL HLISSSTYST FGNKTFYSLH LQGTDQPTGV NCANQNIVGG  240
GRVYLKIY
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G057413
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G057413_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280050.0KJ728005.1 Zea mays clone pUT6138 bHLH transcription factor (bHLH126) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008674508.11e-164PREDICTED: transcription factor bHLH100-like isoform X2
TrEMBLA0A096QRZ10.0A0A096QRZ1_MAIZE; Uncharacterized protein
STRINGGRMZM2G057413_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28261129
MonocotsOGMP32803472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.15e-31bHLH family protein