PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G055413_P01
Common Namecl32977_1(73)
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 267aa    MW: 28591.2 Da    PI: 6.6294
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G055413_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1262e-0895138851
                        HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                        +r   NR A r++R++Kka ++ Lee+v  L a N++L k+l++
  GRMZM2G055413_P01  95 KRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLMKKLQS 138
                        56667**********************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-688155IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.4E-1289156No hitNo description
PfamPF077162.0E-1591145IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.64E-793139No hitNo description
CDDcd146862.49E-11100138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MDDGDLDFSN PDTYLCPALG TDPPSSCSMD SYFDEILKDT EHLACTHTHT CNPPVHDLSH  60
THTCVHVHTK IVAASPGDAE SPSENNSNGN AASKKRPSGN RAAVRKYREK KKAHTASLEE  120
EVVHLRALNQ QLMKKLQSHA ALEAEAARLR CLLVDIRGRI EGEIGAFPYQ RPPAVKNVDL  180
LSSVDQESLL GSAAAQVANS CDFRCNHQMY CNPGMQGAIS GQVLGQGACD VASMQCIGST  240
KSGSTKLPVC GGLDTLPAVC LPNVEKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1180460.0aerial organ| embryo| endosperm| meristem| root| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G055413
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G055413_P01
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0381550.0BT038155.1 Zea mays full-length cDNA clone ZM_BFb0214O22 mRNA, complete cds.
GenBankBT0643620.0BT064362.1 Zea mays full-length cDNA clone ZM_BFc0162G13 mRNA, complete cds.
GenBankBT0835420.0BT083542.1 Zea mays full-length cDNA clone ZM_BFb0009P02 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008647848.10.0uncharacterized protein LOC100282457 isoform X1
RefseqXP_008647850.10.0uncharacterized protein LOC100282457 isoform X1
RefseqXP_008647851.10.0uncharacterized protein LOC100282457 isoform X1
SwissprotQ8VY764e-72BZP19_ARATH; Basic leucine zipper 19
TrEMBLA0A3L6ED120.0A0A3L6ED12_MAIZE; Basic leucine zipper 19
TrEMBLB4FM170.0B4FM17_MAIZE; Uncharacterized protein
TrEMBLK4JRT20.0K4JRT2_MAIZE; BZIP-type transcription factor (Fragment)
STRINGGRMZM2G055413_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Representative plantOGRP19701536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.12e-67bZIP family protein
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]
  2. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  3. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  4. Henriques AR,Farias DDR,Costa de Oliveira A
    Identification and characterization of the bZIP transcription factor involved in zinc homeostasis in cereals.
    Genet. Mol. Res., 2017.
    [PMID:28671251]
  5. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  6. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]