PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G052102_P01
Common NameLOC103654746, ZEAMMB73_192299, Zm.15154
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 258aa    MW: 27339.6 Da    PI: 6.4031
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G052102_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1353e-11126172450
                        XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                         kr +r   NR +A+rsR RK+++i eLe+ v +L+ e +aL  ++ 
  GRMZM2G052102_P01 126 PKRVKRILANRQSAQRSRVRKLQYISELERSVTSLQMEVSALSPRVA 172
                        5999*********************************9999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.6E-13123187IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.415125174IPR004827Basic-leucine zipper domain
PfamPF001705.8E-10125176IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-11127181No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-11127179No hitNo description
CDDcd147031.89E-21128178No hitNo description
PROSITE patternPS000360130145IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MAQLPPRAPS AAPQDHWPPA AGEFLGFAAA RRGAHRRSAS DSAAFLEAVP IDDDVVIGGG  60
GGGGDDFDRL DHDQLLSMFS DVDVSVSVSV SGSAGERAQL MDAGGAGADD GVADSSPAAA  120
DGVAEPKRVK RILANRQSAQ RSRVRKLQYI SELERSVTSL QMEVSALSPR VAFLDHHRSL  180
LTVGNSHLKQ RIAALAQDKI FKDAHQEALE KEIQRLRQVY QQQQVKVATT GGADIATAAS  240
PSMQARQELL ACEGAAIR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.151540.0meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G052102
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots and shoots. {ECO:0000269|PubMed:18065552}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G052102_P01
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By white light. {ECO:0000269|PubMed:18065552}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9687451e-129EU968745.1 Zea mays clone 323889 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008679793.10.0basic leucine zipper 19
SwissprotQ6K3R95e-89BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLA0A3L6F9710.0A0A3L6F971_MAIZE; Basic leucine zipper 19
TrEMBLK7UA520.0K7UA52_MAIZE; Putative bZIP transcription factor superfamily protein
STRINGGRMZM2G052102_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.18e-46bZIP family protein