PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G051793_P01
Common NameZm.148903
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB
Protein Properties Length: 1060aa    MW: 117672 Da    PI: 8.8831
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G051793_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding262.2e-08412455346
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +WT++E+ +l+  +++ G+ +W  Ia t+g+ Rt+ qc  r+q 
  GRMZM2G051793_P01 412 AWTADEETRLLLIIQEKGMCNWIDIAVTLGTYRTPFQCLVRYQR 455
                        8*****************************99*******99995 PP

2Myb_DNA-binding42.91.1e-13464508248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        ++WT+eEd++l  av+ +G + W ++++ +  gRt+ qc +rw+k l
  GRMZM2G051793_P01 464 KAWTKEEDLQLQAAVETFGQK-WQLVSASLD-GRTGTQCSNRWRKTL 508
                        58*******************.*********.************975 PP

3Myb_DNA-binding301.2e-09516560247
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        grW  +Ed++l   vk+ G+g+W++Ia  ++ gRt  q+ +rw + 
  GRMZM2G051793_P01 516 GRWLLDEDKRLMVTVKLIGPGRWSLIAPFIP-GRTQTQIFERWCNI 560
                        89*****************************.***********996 PP

4Myb_DNA-binding34.16.5e-11569612347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         W ++Ed  l+ av ++G+  W++I++t+  gR + +c  rw+k+
  GRMZM2G051793_P01 569 DWRPDEDSTLLAAVSEFGPC-WSKISKTIIPGRNDSMCYRRWRKL 612
                        5*****************88.********99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.063306402IPR017877Myb-like domain
SMARTSM007175.0E-5310406IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-12312329IPR009057Homeodomain-like
CDDcd001670.00132369402No hitNo description
Gene3DG3DSA:1.10.10.608.3E-12376417IPR009057Homeodomain-like
SuperFamilySSF466891.64E-5379422IPR009057Homeodomain-like
PROSITE profilePS500908.084405457IPR017877Myb-like domain
SMARTSM007177.3E-5409459IPR001005SANT/Myb domain
SuperFamilySSF466893.38E-21409504IPR009057Homeodomain-like
PfamPF002498.7E-6411455IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-11418465IPR009057Homeodomain-like
PROSITE profilePS5129419.958458512IPR017930Myb domain
SMARTSM007176.0E-12462510IPR001005SANT/Myb domain
PfamPF002492.2E-12464507IPR001005SANT/Myb domain
CDDcd001679.54E-10465508No hitNo description
Gene3DG3DSA:1.10.10.601.1E-15466510IPR009057Homeodomain-like
SMARTSM007172.5E-7514563IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-13514561IPR009057Homeodomain-like
PfamPF002491.1E-8516561IPR001005SANT/Myb domain
PROSITE profilePS5129415.069516565IPR017930Myb domain
SuperFamilySSF466897.91E-21516609IPR009057Homeodomain-like
CDDcd001676.41E-7517561No hitNo description
Gene3DG3DSA:1.10.10.602.9E-13562616IPR009057Homeodomain-like
SMARTSM007174.2E-7566615IPR001005SANT/Myb domain
PROSITE profilePS5129410.784568617IPR017930Myb domain
PfamPF002494.1E-8569612IPR001005SANT/Myb domain
CDDcd001674.96E-8570612No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 1060 aa     Download sequence    Send to blast
MDWYSDDSDP DIDEDLREDL DALRRSCILS GADPDAAVAQ VSSGLAGPST PALAAAPGAA  60
ADHHHHASSS DDEEDEDLAL VRSIRANLHH LHNSKASTVL PDAAPAPRDD DDPSSRPICT  120
WPPSDTDEEE DDLETLRAIQ RRFSHYQSST STASPKTMKP EASQGVHSDL FADRSGDDFA  180
VQKQNAIVPH GDGFPKAALL LVDALKKNRA YQKFIRRKMV NIEAKIEENK DLRDRVKCLL  240
GYQLSCRKSV SRSLGQKEDP RVRLISPLKS TQPCTKNKYR KIPALFLGPA ENPHVSKYEM  300
ALKQFPMSFK KQPWSDAEKD KLARGIKQQY QETLILDSLN NGSADGDFSA LDMAYALTNG  360
AGNFEVTPEN LRSVLPLINW DKISAMYLPG RSGAECESRW LNCDDPLINH EAWTADEETR  420
LLLIIQEKGM CNWIDIAVTL GTYRTPFQCL VRYQRSLNPH ILNKAWTKEE DLQLQAAVET  480
FGQKWQLVSA SLDGRTGTQC SNRWRKTLHP EKTSVGRWLL DEDKRLMVTV KLIGPGRWSL  540
IAPFIPGRTQ TQIFERWCNI LDPDLYLDDW RPDEDSTLLA AVSEFGPCWS KISKTIIPGR  600
NDSMCYRRWR KLCKHEVQKA REARQLKKAI FQNNFVDREK ERPAICPRDL ISLLPSKGDG  660
CDVAIVRYCK FLCSSCILIS LGGSEKQGEE NHLALSNIVN ISSGLDCVAA NSVLNASSRR  720
PRRVSSGRRS KKHTEGNNIA APDDLNASSS APSSSIKRKS TTGNNVAAKK RSRVSISVNA  780
DNEVEKNRIT DSVAVSEEGL VKKRTRRPKP VGNEGAVRKR GGSNNEVGTN IITESVAVGE  840
EGVVKKRTRR SKPVGNEGAD NEVGTYRITG SVVVGEEGVV KKRTRRSSKP VDNEEVVRKM  900
RGSINNYDEA GTNTMMNSAF GEEEVVKKKT RHSKPVGTEG AASIGGDGMV NKRRTGSVST  960
ENLGAVRKRK IVSSRRKLAE VNLPTEEGVP NAVPDLDFPC AISEERAVDV GNMDKGRRKS  1020
TPRPKQINMP EEDADKNSTF TRLVNCLSFA RMKGIDRNKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-263826593155MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-263826593155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1951969KRRTGSVSTENLGAVRKRK
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G051793
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G051793_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008652002.10.0PREDICTED: uncharacterized protein LOC103631936
RefseqXP_008652003.10.0PREDICTED: uncharacterized protein LOC103631936
TrEMBLA0A096QN110.0A0A096QN11_MAIZE; Uncharacterized protein
STRINGGRMZM2G051793_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Representative plantOGRP73551617
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-137myb domain protein 4r1