PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G047715_P01
Common NameZEAMMB73_616510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 346aa    MW: 37141.8 Da    PI: 5.1833
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G047715_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74e-18180234256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++keq   Le+ F+ +++++ +++ +LAk+l+L  rqV vWFqNrRa+ k
  GRMZM2G047715_P01 180 RKKLRLSKEQSAFLEDSFKAHSTLTPKQKSDLAKRLKLRPRQVEVWFQNRRARSK 234
                        788899***********************************************98 PP

2HD-ZIP_I/II121.44.4e-39180268189
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                        +kk+rlskeq+++LE+sF+++++L+p++K++la++L+l+prqv+vWFqnrRAR k+kq+E+d+e+Lkr++++l++en+rL++ev+eLr+
  GRMZM2G047715_P01 180 RKKLRLSKEQSAFLEDSFKAHSTLTPKQKSDLAKRLKLRPRQVEVWFQNRRARSKLKQTEVDCEYLKRWCEKLAQENRRLQREVAELRR 268
                        69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-17162234IPR009057Homeodomain-like
PROSITE profilePS5007116.811176236IPR001356Homeobox domain
SuperFamilySSF466899.61E-18177245IPR009057Homeodomain-like
SMARTSM003892.5E-16178240IPR001356Homeobox domain
CDDcd000863.29E-17180237No hitNo description
PfamPF000462.1E-15180234IPR001356Homeobox domain
PROSITE patternPS000270211234IPR017970Homeobox, conserved site
SMARTSM003407.4E-19236279IPR003106Leucine zipper, homeobox-associated
PfamPF021831.7E-10236268IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MTSPLLVSYP SSILDMELEL SLGDSRAPAK SASTPAALTP IHAGAGGEGH ELALELGVGA  60
AKRAEQDNQK TPVQPEHVQE EEEEEETCPY SESPAELSLI GCPLLPAASA EIGSVNSSEV  120
CVRRGFGVDA VLVDGGDAAQ GRPALSTSFL PSEFLVRRQA DDQEAAAEDE EMSGVGGGAR  180
KKLRLSKEQS AFLEDSFKAH STLTPKQKSD LAKRLKLRPR QVEVWFQNRR ARSKLKQTEV  240
DCEYLKRWCE KLAQENRRLQ REVAELRRLC SAAYPFYGAA AGFGVATARV CPSSCDNDVS  300
EAAISGAPSA AAPPPSTLFA SWPPHFGPFT VVVPPLLRRQ PSATTS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1228236RRARSKLKQ
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G047715
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G047715_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008678710.10.0homeobox-leucine zipper protein HOX7
SwissprotA2X6741e-93HOX7_ORYSI; Homeobox-leucine zipper protein HOX7
SwissprotQ0E0A69e-94HOX7_ORYSJ; Homeobox-leucine zipper protein HOX7
TrEMBLA0A3L6EZU90.0A0A3L6EZU9_MAIZE; Homeobox-leucine zipper protein HOX7
STRINGGRMZM2G047715_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128943035
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-46homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]