PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G045678_P01
Common NameLOC100283109
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 314aa    MW: 31771.7 Da    PI: 9.106
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G045678_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.41e-3591146560
             zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                          +cprC s++tkfCyynny++sqPr+fC+aCrryWt GG+lrnvPvGg++rk+ +
  GRMZM2G045678_P01  91 GEQCPRCASRDTKFCYYNNYNTSQPRHFCRACRRYWTLGGSLRNVPVGGSTRKRPR 146
                        579*************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2192143IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.77392146IPR003851Zinc finger, Dof-type
PfamPF027015.8E-3192144IPR003851Zinc finger, Dof-type
PROSITE patternPS01361094130IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MAGQVMEAQA CRLQPPTMAP FAPLPHQYNN TCKHLNTTMA ATSGNNNSNG STATAAGGAA  60
ADGMAAYLQH LQQAGAEAAA KSGGGGGAAR GEQCPRCASR DTKFCYYNNY NTSQPRHFCR  120
ACRRYWTLGG SLRNVPVGGS TRKRPRLAHH HQHARLAPPA PHVFGLTPMM PPPLQPSSST  180
SSSQGQGQGQ GQSGGLLGSL FALGAAGAGP PLLEGRGAGS SFDFDLGLGL PTGALHLGAA  240
GQMQGLGLMG GGGASAAGSS SFLWPAAGLL VDNDSVDTWK MPGAAAGSMW PDFSFPAAAA  300
PQTAGLLHGG GHLM
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G045678
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G045678_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0609840.0BT060984.1 Zea mays full-length cDNA clone ZM_BFb0081D20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149483.20.0dof domain, zinc finger family protein
TrEMBLC0HF780.0C0HF78_MAIZE; Dof zinc finger protein DOF1.6
STRINGGRMZM2G045678_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-25DOF zinc finger protein 1