PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G045236_P02
Common NameLOC100281685
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 517aa    MW: 55254.8 Da    PI: 7.3571
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G045236_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.7e-13175236162
                        XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                        e++ +r+ r+++NRe+A+ sRqRKk ++eeLeekvk++ +   +L  +++ +  e a+l+++
  GRMZM2G045236_P02 175 EEDKRRTARLMRNRESAQLSRQRKKRYVEELEEKVKSMHSVINDLSCKISFIAAENATLRQQ 236
                        5677899********************************99999999999999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.9E-14174239IPR004827Basic-leucine zipper domain
PfamPF001702.9E-11176237IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.864177237IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-16179237No hitNo description
SuperFamilySSF579597.5E-12179237No hitNo description
CDDcd147045.12E-19180231No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MAEPAILDPS PFDLRHYPAH LFDPDIPLAA ADFPLGEFAG DDGCDGLDFD VPVDFSIDDF  60
LLRSPDRGHD GDDSGEGSAA GSGPTASSLA SPATSGTNSA VANVGNRKVK HEDSDEGRSG  120
ATPNWSLKRK QVSPGEATSD GAKCRRSGDG DVSPSASASR AATEDSDERG VGGEEEDKRR  180
TARLMRNRES AQLSRQRKKR YVEELEEKVK SMHSVINDLS CKISFIAAEN ATLRQQLGGV  240
GVSGPPPGVY PPPPPGIHFP WVSGYAMRPH GSHVPLVPIP RLKPQHAAAA VKVSKKPDVK  300
KSVESKSKTK TKTKTKKVAS ISLLGLLFVA FVFGAFVPGF NHSLGLRGRS DNVMFGNFGQ  360
SDARVFSVTN HGKGPKGSFN SSDMISTDHD MMTGHDDGAG QKHRAANNSS EILPALLYVP  420
RNGKHVMING NLIIHSVMAS EKAVAHKGSN SQSVKDHKET SVAIARYLSP PGKDMNSKEM  480
FPPDAPLPQW FREGMEGPVL NSGMCSEGQA EKQEDHV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1177199KRRTARLMRNRESAQLSRQRKKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.271870.0meristem| pedicel| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G045236
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in leaf blade, and at lower levels in roots, leaf sheaths, flowers and seeds. {ECO:0000269|PubMed:22084314}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in endoplasmic reticulum (ER) stress response. Acts as ER stress sensor and activates the transcription factor BZIP50 and the chaperone BIP1. {ECO:0000269|PubMed:22050533, ECO:0000269|PubMed:22084314}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G045236_P02
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by dithiothreitol- and tunicamycin-induced endoplasmic reticulum (ER) stress response. {ECO:0000269|PubMed:22084314}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0678080.0BT067808.1 Zea mays full-length cDNA clone ZM_BFc0160D20 mRNA, complete cds.
GenBankEU9575450.0EU957545.1 Zea mays clone 1597058 DNA binding protein mRNA, complete cds.
GenBankKJ7276050.0KJ727605.1 Zea mays clone pUT5465 bZIP transcription factor (bZIP34) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001148077.10.0uncharacterized protein LOC100281685
SwissprotQ6AU900.0BZP39_ORYSJ; bZIP transcription factor 39
TrEMBLA0A3L6EF760.0A0A3L6EF76_MAIZE; BZIP transcription factor 39
TrEMBLB6SXT00.0B6SXT0_MAIZE; BZIP transcription factor
STRINGGRMZM2G045236_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56660.11e-47basic region/leucine zipper motif protein 49
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]
  3. Takahashi H,Kawakatsu T,Wakasa Y,Hayashi S,Takaiwa F
    A rice transmembrane bZIP transcription factor, OsbZIP39, regulates the endoplasmic reticulum stress response.
    Plant Cell Physiol., 2012. 53(1): p. 144-53
    [PMID:22084314]
  4. Ohta M, et al.
    Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.
    J. Exp. Bot., 2013. 64(18): p. 5429-41
    [PMID:24153418]
  5. Cheng Q, et al.
    An alternatively spliced heat shock transcription factor, OsHSFA2dI, functions in the heat stress-induced unfolded protein response in rice.
    Plant Biol (Stuttg), 2015. 17(2): p. 419-29
    [PMID:25255693]